KEGG   Camelus ferus (Wild Bactrian camel): 102509404
Entry
102509404         CDS       T02979                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X2
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04012  ErbB signaling pathway
cfr04066  HIF-1 signaling pathway
cfr04068  FoxO signaling pathway
cfr04110  Cell cycle
cfr04115  p53 signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04218  Cellular senescence
cfr04630  JAK-STAT signaling pathway
cfr04921  Oxytocin signaling pathway
cfr04928  Parathyroid hormone synthesis, secretion and action
cfr04934  Cushing syndrome
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05163  Human cytomegalovirus infection
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05169  Epstein-Barr virus infection
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05203  Viral carcinogenesis
cfr05205  Proteoglycans in cancer
cfr05206  MicroRNAs in cancer
cfr05210  Colorectal cancer
cfr05211  Renal cell carcinoma
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05215  Prostate cancer
cfr05216  Thyroid cancer
cfr05217  Basal cell carcinoma
cfr05218  Melanoma
cfr05219  Bladder cancer
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102509404 (CDKN1A)
   04630 JAK-STAT signaling pathway
    102509404 (CDKN1A)
   04066 HIF-1 signaling pathway
    102509404 (CDKN1A)
   04068 FoxO signaling pathway
    102509404 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    102509404 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102509404 (CDKN1A)
   04115 p53 signaling pathway
    102509404 (CDKN1A)
   04218 Cellular senescence
    102509404 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102509404 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    102509404 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102509404 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    102509404 (CDKN1A)
   05206 MicroRNAs in cancer
    102509404 (CDKN1A)
   05205 Proteoglycans in cancer
    102509404 (CDKN1A)
   05203 Viral carcinogenesis
    102509404 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102509404 (CDKN1A)
   05212 Pancreatic cancer
    102509404 (CDKN1A)
   05225 Hepatocellular carcinoma
    102509404 (CDKN1A)
   05226 Gastric cancer
    102509404 (CDKN1A)
   05214 Glioma
    102509404 (CDKN1A)
   05216 Thyroid cancer
    102509404 (CDKN1A)
   05220 Chronic myeloid leukemia
    102509404 (CDKN1A)
   05217 Basal cell carcinoma
    102509404 (CDKN1A)
   05218 Melanoma
    102509404 (CDKN1A)
   05211 Renal cell carcinoma
    102509404 (CDKN1A)
   05219 Bladder cancer
    102509404 (CDKN1A)
   05215 Prostate cancer
    102509404 (CDKN1A)
   05213 Endometrial cancer
    102509404 (CDKN1A)
   05224 Breast cancer
    102509404 (CDKN1A)
   05222 Small cell lung cancer
    102509404 (CDKN1A)
   05223 Non-small cell lung cancer
    102509404 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102509404 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102509404 (CDKN1A)
   05161 Hepatitis B
    102509404 (CDKN1A)
   05160 Hepatitis C
    102509404 (CDKN1A)
   05163 Human cytomegalovirus infection
    102509404 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102509404 (CDKN1A)
   05169 Epstein-Barr virus infection
    102509404 (CDKN1A)
   05165 Human papillomavirus infection
    102509404 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102509404 (CDKN1A)
   01522 Endocrine resistance
    102509404 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102509404
NCBI-ProteinID: XP_014423732
LinkDB
Position
20
AA seq 164 aa
MSEPSRDAHQIPRSSKACRRLFGPVDSEQLSRDCDALMASCVQEARDRWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPAGPRGAWDDLGGGKRPSTSPALLQGTSQEDHVDLSLSCTLV
PRSPERPEESPGGPGTSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcggagccatccagggatgcccatcagatcccacgcagcagcaaggcgtgccgtcgc
ctcttcggcccagtggacagtgagcaactgagccgggactgtgacgcactgatggccagc
tgtgtgcaggaggcccgggatcgatggaacttcgactttgtcaccgagacaccgctggag
ggtgactttgcctgggagcgtgtgcggggccttggcctgcccaagctctacctgcctgca
gggccccggggggcctgggatgacctgggagggggcaagcggcccagcacctcgcctgcc
ctgctgcaggggacatctcaggaggaccacgtggacctgtcactgtcttgcacccttgtg
cctcgctcccctgagcggcctgaggagtccccaggtgggcctggcacctctcagggccga
aaacggcggcagaccagcatgacagatttctatcactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system