Camelus ferus (Wild Bactrian camel): 102509562 Help Entry 102509562         CDS       T02979                                  Gene name NRAS Definition (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr01521   EGFR tyrosine kinase inhibitor resistance cfr01522   Endocrine resistance cfr04010   MAPK signaling pathway cfr04012   ErbB signaling pathway cfr04014   Ras signaling pathway cfr04015   Rap1 signaling pathway cfr04062   Chemokine signaling pathway cfr04068   FoxO signaling pathway cfr04071   Sphingolipid signaling pathway cfr04072   Phospholipase D signaling pathway cfr04137   Mitophagy - animal cfr04140   Autophagy - animal cfr04150   mTOR signaling pathway cfr04151   PI3K-Akt signaling pathway cfr04210   Apoptosis cfr04211   Longevity regulating pathway cfr04213   Longevity regulating pathway - multiple species cfr04218   Cellular senescence cfr04360   Axon guidance cfr04370   VEGF signaling pathway cfr04371   Apelin signaling pathway cfr04540   Gap junction cfr04550   Signaling pathways regulating pluripotency of stem cells cfr04625   C-type lectin receptor signaling pathway cfr04650   Natural killer cell mediated cytotoxicity cfr04660   T cell receptor signaling pathway cfr04662   B cell receptor signaling pathway cfr04664   Fc epsilon RI signaling pathway cfr04714   Thermogenesis cfr04720   Long-term potentiation cfr04722   Neurotrophin signaling pathway cfr04725   Cholinergic synapse cfr04726   Serotonergic synapse cfr04730   Long-term depression cfr04810   Regulation of actin cytoskeleton cfr04910   Insulin signaling pathway cfr04912   GnRH signaling pathway cfr04915   Estrogen signaling pathway cfr04916   Melanogenesis cfr04917   Prolactin signaling pathway cfr04919   Thyroid hormone signaling pathway cfr04921   Oxytocin signaling pathway cfr04926   Relaxin signaling pathway cfr04929   GnRH secretion cfr04933   AGE-RAGE signaling pathway in diabetic complications cfr04935   Growth hormone synthesis, secretion and action cfr05010   Alzheimer disease cfr05022   Pathways of neurodegeneration - multiple diseases cfr05034   Alcoholism cfr05160   Hepatitis C cfr05161   Hepatitis B cfr05163   Human cytomegalovirus infection cfr05165   Human papillomavirus infection cfr05166   Human T-cell leukemia virus 1 infection cfr05167   Kaposi sarcoma-associated herpesvirus infection cfr05170   Human immunodeficiency virus 1 infection cfr05200   Pathways in cancer cfr05203   Viral carcinogenesis cfr05205   Proteoglycans in cancer cfr05206   MicroRNAs in cancer cfr05210   Colorectal cancer cfr05211   Renal cell carcinoma cfr05213   Endometrial cancer cfr05214   Glioma cfr05215   Prostate cancer cfr05216   Thyroid cancer cfr05218   Melanoma cfr05219   Bladder cancer cfr05220   Chronic myeloid leukemia cfr05221   Acute myeloid leukemia cfr05223   Non-small cell lung cancer cfr05224   Breast cancer cfr05225   Hepatocellular carcinoma cfr05226   Gastric cancer cfr05230   Central carbon metabolism in cancer cfr05231   Choline metabolism in cancer cfr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102509562 (NRAS)    04012 ErbB signaling pathway     102509562 (NRAS)    04014 Ras signaling pathway     102509562 (NRAS)    04015 Rap1 signaling pathway     102509562 (NRAS)    04370 VEGF signaling pathway     102509562 (NRAS)    04371 Apelin signaling pathway     102509562 (NRAS)    04068 FoxO signaling pathway     102509562 (NRAS)    04072 Phospholipase D signaling pathway     102509562 (NRAS)    04071 Sphingolipid signaling pathway     102509562 (NRAS)    04151 PI3K-Akt signaling pathway     102509562 (NRAS)    04150 mTOR signaling pathway     102509562 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102509562 (NRAS)    04137 Mitophagy - animal     102509562 (NRAS)   09143 Cell growth and death    04210 Apoptosis     102509562 (NRAS)    04218 Cellular senescence     102509562 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     102509562 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     102509562 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102509562 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102509562 (NRAS)    04650 Natural killer cell mediated cytotoxicity     102509562 (NRAS)    04660 T cell receptor signaling pathway     102509562 (NRAS)    04662 B cell receptor signaling pathway     102509562 (NRAS)    04664 Fc epsilon RI signaling pathway     102509562 (NRAS)    04062 Chemokine signaling pathway     102509562 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102509562 (NRAS)    04929 GnRH secretion     102509562 (NRAS)    04912 GnRH signaling pathway     102509562 (NRAS)    04915 Estrogen signaling pathway     102509562 (NRAS)    04917 Prolactin signaling pathway     102509562 (NRAS)    04921 Oxytocin signaling pathway     102509562 (NRAS)    04926 Relaxin signaling pathway     102509562 (NRAS)    04935 Growth hormone synthesis, secretion and action     102509562 (NRAS)    04919 Thyroid hormone signaling pathway     102509562 (NRAS)    04916 Melanogenesis     102509562 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     102509562 (NRAS)    04726 Serotonergic synapse     102509562 (NRAS)    04720 Long-term potentiation     102509562 (NRAS)    04730 Long-term depression     102509562 (NRAS)    04722 Neurotrophin signaling pathway     102509562 (NRAS)   09158 Development and regeneration    04360 Axon guidance     102509562 (NRAS)   09149 Aging    04211 Longevity regulating pathway     102509562 (NRAS)    04213 Longevity regulating pathway - multiple species     102509562 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     102509562 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102509562 (NRAS)    05206 MicroRNAs in cancer     102509562 (NRAS)    05205 Proteoglycans in cancer     102509562 (NRAS)    05203 Viral carcinogenesis     102509562 (NRAS)    05230 Central carbon metabolism in cancer     102509562 (NRAS)    05231 Choline metabolism in cancer     102509562 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102509562 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     102509562 (NRAS)    05225 Hepatocellular carcinoma     102509562 (NRAS)    05226 Gastric cancer     102509562 (NRAS)    05214 Glioma     102509562 (NRAS)    05216 Thyroid cancer     102509562 (NRAS)    05221 Acute myeloid leukemia     102509562 (NRAS)    05220 Chronic myeloid leukemia     102509562 (NRAS)    05218 Melanoma     102509562 (NRAS)    05211 Renal cell carcinoma     102509562 (NRAS)    05219 Bladder cancer     102509562 (NRAS)    05215 Prostate cancer     102509562 (NRAS)    05213 Endometrial cancer     102509562 (NRAS)    05224 Breast cancer     102509562 (NRAS)    05223 Non-small cell lung cancer     102509562 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102509562 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     102509562 (NRAS)   09165 Substance dependence    05034 Alcoholism     102509562 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102509562 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102509562 (NRAS)    05170 Human immunodeficiency virus 1 infection     102509562 (NRAS)    05161 Hepatitis B     102509562 (NRAS)    05160 Hepatitis C     102509562 (NRAS)    05163 Human cytomegalovirus infection     102509562 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102509562 (NRAS)    05165 Human papillomavirus infection     102509562 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102509562 (NRAS)    01522 Endocrine resistance     102509562 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfr04131]     102509562 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102509562 (NRAS)    04031 GTP-binding proteins [BR:cfr04031]     102509562 (NRAS) Membrane trafficking [BR:cfr04131]  Endocytosis   Macropinocytosis    Ras GTPases     102509562 (NRAS) Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102509562 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    102509562 (NRAS)   Exosomal proteins of breast cancer cells    102509562 (NRAS)   Exosomal proteins of colorectal cancer cells    102509562 (NRAS) GTP-binding proteins [BR:cfr04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102509562 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N Motif Other DBs NCBI-GeneID:  102509562 NCBI-ProteinID:  XP_006193222 LinkDB All DBs Position 9 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaagtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aaacgagtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca ttcatcgaaacctcagccaagaccagacagggtgttgaagatgccttttatacactggta agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatggaactcaaggt tgtatggggttgccgtgtgtggtgatgtaa

Camelus ferus (Wild Bactrian camel): 102516372 Help Entry 102516372         CDS       T02979                                  Gene name KRAS Definition (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr01521   EGFR tyrosine kinase inhibitor resistance cfr01522   Endocrine resistance cfr04010   MAPK signaling pathway cfr04012   ErbB signaling pathway cfr04014   Ras signaling pathway cfr04015   Rap1 signaling pathway cfr04062   Chemokine signaling pathway cfr04068   FoxO signaling pathway cfr04071   Sphingolipid signaling pathway cfr04072   Phospholipase D signaling pathway cfr04137   Mitophagy - animal cfr04140   Autophagy - animal cfr04150   mTOR signaling pathway cfr04151   PI3K-Akt signaling pathway cfr04210   Apoptosis cfr04211   Longevity regulating pathway cfr04213   Longevity regulating pathway - multiple species cfr04218   Cellular senescence cfr04360   Axon guidance cfr04370   VEGF signaling pathway cfr04371   Apelin signaling pathway cfr04540   Gap junction cfr04550   Signaling pathways regulating pluripotency of stem cells cfr04625   C-type lectin receptor signaling pathway cfr04650   Natural killer cell mediated cytotoxicity cfr04660   T cell receptor signaling pathway cfr04662   B cell receptor signaling pathway cfr04664   Fc epsilon RI signaling pathway cfr04714   Thermogenesis cfr04720   Long-term potentiation cfr04722   Neurotrophin signaling pathway cfr04725   Cholinergic synapse cfr04726   Serotonergic synapse cfr04730   Long-term depression cfr04810   Regulation of actin cytoskeleton cfr04910   Insulin signaling pathway cfr04912   GnRH signaling pathway cfr04914   Progesterone-mediated oocyte maturation cfr04915   Estrogen signaling pathway cfr04916   Melanogenesis cfr04917   Prolactin signaling pathway cfr04919   Thyroid hormone signaling pathway cfr04921   Oxytocin signaling pathway cfr04926   Relaxin signaling pathway cfr04929   GnRH secretion cfr04933   AGE-RAGE signaling pathway in diabetic complications cfr04935   Growth hormone synthesis, secretion and action cfr04960   Aldosterone-regulated sodium reabsorption cfr05010   Alzheimer disease cfr05022   Pathways of neurodegeneration - multiple diseases cfr05034   Alcoholism cfr05160   Hepatitis C cfr05161   Hepatitis B cfr05163   Human cytomegalovirus infection cfr05165   Human papillomavirus infection cfr05166   Human T-cell leukemia virus 1 infection cfr05167   Kaposi sarcoma-associated herpesvirus infection cfr05170   Human immunodeficiency virus 1 infection cfr05200   Pathways in cancer cfr05203   Viral carcinogenesis cfr05205   Proteoglycans in cancer cfr05206   MicroRNAs in cancer cfr05210   Colorectal cancer cfr05211   Renal cell carcinoma cfr05212   Pancreatic cancer cfr05213   Endometrial cancer cfr05214   Glioma cfr05215   Prostate cancer cfr05216   Thyroid cancer cfr05218   Melanoma cfr05219   Bladder cancer cfr05220   Chronic myeloid leukemia cfr05221   Acute myeloid leukemia cfr05223   Non-small cell lung cancer cfr05224   Breast cancer cfr05225   Hepatocellular carcinoma cfr05226   Gastric cancer cfr05230   Central carbon metabolism in cancer cfr05231   Choline metabolism in cancer cfr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102516372 (KRAS)    04012 ErbB signaling pathway     102516372 (KRAS)    04014 Ras signaling pathway     102516372 (KRAS)    04015 Rap1 signaling pathway     102516372 (KRAS)    04370 VEGF signaling pathway     102516372 (KRAS)    04371 Apelin signaling pathway     102516372 (KRAS)    04068 FoxO signaling pathway     102516372 (KRAS)    04072 Phospholipase D signaling pathway     102516372 (KRAS)    04071 Sphingolipid signaling pathway     102516372 (KRAS)    04151 PI3K-Akt signaling pathway     102516372 (KRAS)    04150 mTOR signaling pathway     102516372 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102516372 (KRAS)    04137 Mitophagy - animal     102516372 (KRAS)   09143 Cell growth and death    04210 Apoptosis     102516372 (KRAS)    04218 Cellular senescence     102516372 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     102516372 (KRAS)    04550 Signaling pathways regulating pluripotency of stem cells     102516372 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102516372 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102516372 (KRAS)    04650 Natural killer cell mediated cytotoxicity     102516372 (KRAS)    04660 T cell receptor signaling pathway     102516372 (KRAS)    04662 B cell receptor signaling pathway     102516372 (KRAS)    04664 Fc epsilon RI signaling pathway     102516372 (KRAS)    04062 Chemokine signaling pathway     102516372 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102516372 (KRAS)    04929 GnRH secretion     102516372 (KRAS)    04912 GnRH signaling pathway     102516372 (KRAS)    04915 Estrogen signaling pathway     102516372 (KRAS)    04914 Progesterone-mediated oocyte maturation     102516372 (KRAS)    04917 Prolactin signaling pathway     102516372 (KRAS)    04921 Oxytocin signaling pathway     102516372 (KRAS)    04926 Relaxin signaling pathway     102516372 (KRAS)    04935 Growth hormone synthesis, secretion and action     102516372 (KRAS)    04919 Thyroid hormone signaling pathway     102516372 (KRAS)    04916 Melanogenesis     102516372 (KRAS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102516372 (KRAS)   09156 Nervous system    04725 Cholinergic synapse     102516372 (KRAS)    04726 Serotonergic synapse     102516372 (KRAS)    04720 Long-term potentiation     102516372 (KRAS)    04730 Long-term depression     102516372 (KRAS)    04722 Neurotrophin signaling pathway     102516372 (KRAS)   09158 Development and regeneration    04360 Axon guidance     102516372 (KRAS)   09149 Aging    04211 Longevity regulating pathway     102516372 (KRAS)    04213 Longevity regulating pathway - multiple species     102516372 (KRAS)   09159 Environmental adaptation    04714 Thermogenesis     102516372 (KRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102516372 (KRAS)    05206 MicroRNAs in cancer     102516372 (KRAS)    05205 Proteoglycans in cancer     102516372 (KRAS)    05203 Viral carcinogenesis     102516372 (KRAS)    05230 Central carbon metabolism in cancer     102516372 (KRAS)    05231 Choline metabolism in cancer     102516372 (KRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102516372 (KRAS)   09162 Cancer: specific types    05210 Colorectal cancer     102516372 (KRAS)    05212 Pancreatic cancer     102516372 (KRAS)    05225 Hepatocellular carcinoma     102516372 (KRAS)    05226 Gastric cancer     102516372 (KRAS)    05214 Glioma     102516372 (KRAS)    05216 Thyroid cancer     102516372 (KRAS)    05221 Acute myeloid leukemia     102516372 (KRAS)    05220 Chronic myeloid leukemia     102516372 (KRAS)    05218 Melanoma     102516372 (KRAS)    05211 Renal cell carcinoma     102516372 (KRAS)    05219 Bladder cancer     102516372 (KRAS)    05215 Prostate cancer     102516372 (KRAS)    05213 Endometrial cancer     102516372 (KRAS)    05224 Breast cancer     102516372 (KRAS)    05223 Non-small cell lung cancer     102516372 (KRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102516372 (KRAS)    05022 Pathways of neurodegeneration - multiple diseases     102516372 (KRAS)   09165 Substance dependence    05034 Alcoholism     102516372 (KRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102516372 (KRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102516372 (KRAS)    05170 Human immunodeficiency virus 1 infection     102516372 (KRAS)    05161 Hepatitis B     102516372 (KRAS)    05160 Hepatitis C     102516372 (KRAS)    05163 Human cytomegalovirus infection     102516372 (KRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102516372 (KRAS)    05165 Human papillomavirus infection     102516372 (KRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102516372 (KRAS)    01522 Endocrine resistance     102516372 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfr04131]     102516372 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:cfr04031]     102516372 (KRAS) Membrane trafficking [BR:cfr04131]  Endocytosis   Macropinocytosis    Ras GTPases     102516372 (KRAS) GTP-binding proteins [BR:cfr04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102516372 (KRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha ATP_bind_1 FeoB_N Gtr1_RagA Septin AAA_25 CbiA Motif Other DBs NCBI-GeneID:  102516372 NCBI-ProteinID:  XP_032329193 LinkDB All DBs Position 34 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKICKEEKTPGC VKIKKCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg atacagctaattcagaatcactttgtggacgaatatgatcctacgatagaggattcctac aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt gtatttgccataaataatactaagtcatttgaagatattcaccattatagagaacaaata aaaagagttaaagactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattccc ttcattgaaacatcagcaaaaacaagacagagagtggaggatgctttctatacattggtg agagagatccgacaatacagattgaaaaaaatctgcaaagaagaaaagactcctggctgt gtgaaaattaaaaaatgcattgtaatgtaa

Camelus ferus (Wild Bactrian camel): 102524334 Help Entry 102524334         CDS       T02979                                  Gene name HRAS Definition (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr01521   EGFR tyrosine kinase inhibitor resistance cfr01522   Endocrine resistance cfr04010   MAPK signaling pathway cfr04012   ErbB signaling pathway cfr04014   Ras signaling pathway cfr04015   Rap1 signaling pathway cfr04062   Chemokine signaling pathway cfr04068   FoxO signaling pathway cfr04071   Sphingolipid signaling pathway cfr04072   Phospholipase D signaling pathway cfr04137   Mitophagy - animal cfr04140   Autophagy - animal cfr04144   Endocytosis cfr04150   mTOR signaling pathway cfr04151   PI3K-Akt signaling pathway cfr04210   Apoptosis cfr04211   Longevity regulating pathway cfr04213   Longevity regulating pathway - multiple species cfr04218   Cellular senescence cfr04360   Axon guidance cfr04370   VEGF signaling pathway cfr04371   Apelin signaling pathway cfr04510   Focal adhesion cfr04540   Gap junction cfr04550   Signaling pathways regulating pluripotency of stem cells cfr04625   C-type lectin receptor signaling pathway cfr04630   JAK-STAT signaling pathway cfr04650   Natural killer cell mediated cytotoxicity cfr04660   T cell receptor signaling pathway cfr04662   B cell receptor signaling pathway cfr04664   Fc epsilon RI signaling pathway cfr04714   Thermogenesis cfr04720   Long-term potentiation cfr04722   Neurotrophin signaling pathway cfr04725   Cholinergic synapse cfr04726   Serotonergic synapse cfr04730   Long-term depression cfr04810   Regulation of actin cytoskeleton cfr04910   Insulin signaling pathway cfr04912   GnRH signaling pathway cfr04915   Estrogen signaling pathway cfr04916   Melanogenesis cfr04917   Prolactin signaling pathway cfr04919   Thyroid hormone signaling pathway cfr04921   Oxytocin signaling pathway cfr04926   Relaxin signaling pathway cfr04929   GnRH secretion cfr04933   AGE-RAGE signaling pathway in diabetic complications cfr04935   Growth hormone synthesis, secretion and action cfr05010   Alzheimer disease cfr05022   Pathways of neurodegeneration - multiple diseases cfr05034   Alcoholism cfr05132   Salmonella infection cfr05160   Hepatitis C cfr05161   Hepatitis B cfr05163   Human cytomegalovirus infection cfr05165   Human papillomavirus infection cfr05166   Human T-cell leukemia virus 1 infection cfr05167   Kaposi sarcoma-associated herpesvirus infection cfr05170   Human immunodeficiency virus 1 infection cfr05200   Pathways in cancer cfr05203   Viral carcinogenesis cfr05205   Proteoglycans in cancer cfr05206   MicroRNAs in cancer cfr05210   Colorectal cancer cfr05211   Renal cell carcinoma cfr05213   Endometrial cancer cfr05214   Glioma cfr05215   Prostate cancer cfr05216   Thyroid cancer cfr05218   Melanoma cfr05219   Bladder cancer cfr05220   Chronic myeloid leukemia cfr05221   Acute myeloid leukemia cfr05223   Non-small cell lung cancer cfr05224   Breast cancer cfr05225   Hepatocellular carcinoma cfr05226   Gastric cancer cfr05230   Central carbon metabolism in cancer cfr05231   Choline metabolism in cancer cfr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102524334 (HRAS)    04012 ErbB signaling pathway     102524334 (HRAS)    04014 Ras signaling pathway     102524334 (HRAS)    04015 Rap1 signaling pathway     102524334 (HRAS)    04370 VEGF signaling pathway     102524334 (HRAS)    04371 Apelin signaling pathway     102524334 (HRAS)    04630 JAK-STAT signaling pathway     102524334 (HRAS)    04068 FoxO signaling pathway     102524334 (HRAS)    04072 Phospholipase D signaling pathway     102524334 (HRAS)    04071 Sphingolipid signaling pathway     102524334 (HRAS)    04151 PI3K-Akt signaling pathway     102524334 (HRAS)    04150 mTOR signaling pathway     102524334 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102524334 (HRAS)    04140 Autophagy - animal     102524334 (HRAS)    04137 Mitophagy - animal     102524334 (HRAS)   09143 Cell growth and death    04210 Apoptosis     102524334 (HRAS)    04218 Cellular senescence     102524334 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102524334 (HRAS)    04540 Gap junction     102524334 (HRAS)    04550 Signaling pathways regulating pluripotency of stem cells     102524334 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102524334 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102524334 (HRAS)    04650 Natural killer cell mediated cytotoxicity     102524334 (HRAS)    04660 T cell receptor signaling pathway     102524334 (HRAS)    04662 B cell receptor signaling pathway     102524334 (HRAS)    04664 Fc epsilon RI signaling pathway     102524334 (HRAS)    04062 Chemokine signaling pathway     102524334 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102524334 (HRAS)    04929 GnRH secretion     102524334 (HRAS)    04912 GnRH signaling pathway     102524334 (HRAS)    04915 Estrogen signaling pathway     102524334 (HRAS)    04917 Prolactin signaling pathway     102524334 (HRAS)    04921 Oxytocin signaling pathway     102524334 (HRAS)    04926 Relaxin signaling pathway     102524334 (HRAS)    04935 Growth hormone synthesis, secretion and action     102524334 (HRAS)    04919 Thyroid hormone signaling pathway     102524334 (HRAS)    04916 Melanogenesis     102524334 (HRAS)   09156 Nervous system    04725 Cholinergic synapse     102524334 (HRAS)    04726 Serotonergic synapse     102524334 (HRAS)    04720 Long-term potentiation     102524334 (HRAS)    04730 Long-term depression     102524334 (HRAS)    04722 Neurotrophin signaling pathway     102524334 (HRAS)   09158 Development and regeneration    04360 Axon guidance     102524334 (HRAS)   09149 Aging    04211 Longevity regulating pathway     102524334 (HRAS)    04213 Longevity regulating pathway - multiple species     102524334 (HRAS)   09159 Environmental adaptation    04714 Thermogenesis     102524334 (HRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102524334 (HRAS)    05206 MicroRNAs in cancer     102524334 (HRAS)    05205 Proteoglycans in cancer     102524334 (HRAS)    05203 Viral carcinogenesis     102524334 (HRAS)    05230 Central carbon metabolism in cancer     102524334 (HRAS)    05231 Choline metabolism in cancer     102524334 (HRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102524334 (HRAS)   09162 Cancer: specific types    05210 Colorectal cancer     102524334 (HRAS)    05225 Hepatocellular carcinoma     102524334 (HRAS)    05226 Gastric cancer     102524334 (HRAS)    05214 Glioma     102524334 (HRAS)    05216 Thyroid cancer     102524334 (HRAS)    05221 Acute myeloid leukemia     102524334 (HRAS)    05220 Chronic myeloid leukemia     102524334 (HRAS)    05218 Melanoma     102524334 (HRAS)    05211 Renal cell carcinoma     102524334 (HRAS)    05219 Bladder cancer     102524334 (HRAS)    05215 Prostate cancer     102524334 (HRAS)    05213 Endometrial cancer     102524334 (HRAS)    05224 Breast cancer     102524334 (HRAS)    05223 Non-small cell lung cancer     102524334 (HRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102524334 (HRAS)    05022 Pathways of neurodegeneration - multiple diseases     102524334 (HRAS)   09165 Substance dependence    05034 Alcoholism     102524334 (HRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102524334 (HRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     102524334 (HRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102524334 (HRAS)    05170 Human immunodeficiency virus 1 infection     102524334 (HRAS)    05161 Hepatitis B     102524334 (HRAS)    05160 Hepatitis C     102524334 (HRAS)    05163 Human cytomegalovirus infection     102524334 (HRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102524334 (HRAS)    05165 Human papillomavirus infection     102524334 (HRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102524334 (HRAS)    01522 Endocrine resistance     102524334 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfr04131]     102524334 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfr04147]     102524334 (HRAS)    04031 GTP-binding proteins [BR:cfr04031]     102524334 (HRAS) Membrane trafficking [BR:cfr04131]  Endocytosis   Macropinocytosis    Ras GTPases     102524334 (HRAS) Exosome [BR:cfr04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102524334 (HRAS)   Exosomal proteins of colorectal cancer cells    102524334 (HRAS) GTP-binding proteins [BR:cfr04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102524334 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  102524334 NCBI-ProteinID:  XP_032346264 LinkDB All DBs Position 10 AA seq 197 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVEARQAQDLARSYGIPYIETSAKTRQGRLWFRLQLRDPLGPSGTPGTQQPLALGWR TPSTRWCERSGSTRCAS NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagctcgtagtggtgggcgccggaggcgtggggaagagcgcgctgacc atccagctcattcagaaccacttcgtggacgagtacgaccccaccatagaggactcctac cggaagcaagtagtcattgatggggagacatgcctgctggacatcctggacacagcaggc caggaggagtacagcgctatgcgggaccaatacatgcgcaccggggagggcttcctctgt gtgttcgccatcaacaacaccaagtcctttgaggacatccaccagtacagggagcagatc aagcgggtgaaggactcggacgacgtgcccatggtgctggtggggaacaagtgtgacctg gccgcccgcaccgtggaggctcggcaagcccaggacctcgcccgcagctacggcatcccc tacattgagacttcagccaagactcgccagggcagactctggttcaggctccagctccgg gaccccctgggaccctccgggacccccgggacccagcagcccctggcgctggggtggagg acgccttctacacgctggtgcgagagatccggcagcacaaggtgcgcaagctga

DBGET integrated database retrieval system