KEGG   Camelus ferus (Wild Bactrian camel): 102512073
Entry
102512073         CDS       T02979                                 

Definition
(RefSeq) ferritin light chain isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr01524  Platinum drug resistance
cfr04071  Sphingolipid signaling pathway
cfr04115  p53 signaling pathway
cfr04141  Protein processing in endoplasmic reticulum
cfr04210  Apoptosis
cfr04211  Longevity regulating pathway
cfr04215  Apoptosis - multiple species
cfr04217  Necroptosis
cfr04722  Neurotrophin signaling pathway
cfr04932  Non-alcoholic fatty liver disease
cfr04933  AGE-RAGE signaling pathway in diabetic complications
cfr05012  Parkinson disease
cfr05014  Amyotrophic lateral sclerosis
cfr05016  Huntington disease
cfr05020  Prion disease
cfr05022  Pathways of neurodegeneration - multiple diseases
cfr05132  Salmonella infection
cfr05152  Tuberculosis
cfr05160  Hepatitis C
cfr05161  Hepatitis B
cfr05162  Measles
cfr05163  Human cytomegalovirus infection
cfr05164  Influenza A
cfr05165  Human papillomavirus infection
cfr05166  Human T-cell leukemia virus 1 infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05169  Epstein-Barr virus infection
cfr05170  Human immunodeficiency virus 1 infection
cfr05200  Pathways in cancer
cfr05202  Transcriptional misregulation in cancer
cfr05203  Viral carcinogenesis
cfr05210  Colorectal cancer
cfr05212  Pancreatic cancer
cfr05213  Endometrial cancer
cfr05214  Glioma
cfr05216  Thyroid cancer
cfr05217  Basal cell carcinoma
cfr05218  Melanoma
cfr05220  Chronic myeloid leukemia
cfr05222  Small cell lung cancer
cfr05223  Non-small cell lung cancer
cfr05224  Breast cancer
cfr05225  Hepatocellular carcinoma
cfr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102512073
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102512073
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102512073
   04215 Apoptosis - multiple species
    102512073
   04217 Necroptosis
    102512073
   04115 p53 signaling pathway
    102512073
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102512073
  09149 Aging
   04211 Longevity regulating pathway
    102512073
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102512073
   05202 Transcriptional misregulation in cancer
    102512073
   05203 Viral carcinogenesis
    102512073
  09162 Cancer: specific types
   05210 Colorectal cancer
    102512073
   05212 Pancreatic cancer
    102512073
   05225 Hepatocellular carcinoma
    102512073
   05226 Gastric cancer
    102512073
   05214 Glioma
    102512073
   05216 Thyroid cancer
    102512073
   05220 Chronic myeloid leukemia
    102512073
   05217 Basal cell carcinoma
    102512073
   05218 Melanoma
    102512073
   05213 Endometrial cancer
    102512073
   05224 Breast cancer
    102512073
   05222 Small cell lung cancer
    102512073
   05223 Non-small cell lung cancer
    102512073
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102512073
   05014 Amyotrophic lateral sclerosis
    102512073
   05016 Huntington disease
    102512073
   05020 Prion disease
    102512073
   05022 Pathways of neurodegeneration - multiple diseases
    102512073
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102512073
   04933 AGE-RAGE signaling pathway in diabetic complications
    102512073
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102512073
   05152 Tuberculosis
    102512073
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102512073
   05170 Human immunodeficiency virus 1 infection
    102512073
   05161 Hepatitis B
    102512073
   05160 Hepatitis C
    102512073
   05164 Influenza A
    102512073
   05162 Measles
    102512073
   05168 Herpes simplex virus 1 infection
    102512073
   05163 Human cytomegalovirus infection
    102512073
   05167 Kaposi sarcoma-associated herpesvirus infection
    102512073
   05169 Epstein-Barr virus infection
    102512073
   05165 Human papillomavirus infection
    102512073
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102512073
   01524 Platinum drug resistance
    102512073
   01522 Endocrine resistance
    102512073
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cfr03029]
    102512073
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfr02000]
    102512073
Mitochondrial biogenesis [BR:cfr03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102512073
Transporters [BR:cfr02000]
 Other transporters
  Pores ion channels [TC:1]
   102512073
SSDB
Motif
Pfam: Ferritin ANAPC4
Other DBs
NCBI-GeneID: 102512073
NCBI-ProteinID: XP_032341478
LinkDB
Position
9
AA seq 324 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQIPQDASTKKLS
ECLKRIGDELDSNMELQRCALALGGPADLSLASTVFGRNRPRGRPLLQPPTTLQPFFQSH
PSEPATVLSSASGTSQHRFVSLTPYYGSTMSSQIRQNYSSEVEASVNHLVNMHLRASYTY
LSLGFYFDRDDVALEGVGHFFRELAEEKREGAERLLKMQNQRGGRALFQDVQKPSQDEWG
KTQDAMEAAIALEKNLNQALLDLHALGSARADPHLCDFLENHFLDEEVKLIKKMGDHLTN
LRRLSGPQAGLGEYLFERLTLKHD
NT seq 975 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcaacccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatgggggga
gagacacctgagctgggcctggagcagattccccaggatgcgtccaccaagaagctgagc
gagtgtctcaagcgcatcggagatgaactcgacagtaacatggagttgcagaggtgtgct
cttgcgctcggcggtcctgcggatctgtctcttgcttcaacagtgtttggacggaacaga
cccaggggacgccccttgctccagcctccgaccacccttcaaccttttttccagtcgcat
ccttcagaaccagccactgtgctatcttcagcctctgggaccagccaacaccgttttgtg
agcttaactccttattacggatcaaccatgagctcccagattcgtcagaattattccagc
gaggttgaggcctctgtcaaccacctggtcaacatgcatctgcgggcctcctacacctac
ctctctctgggcttctatttcgaccgcgacgatgtggctctggagggtgttggccacttt
ttccgcgaattggctgaggagaagcgcgagggcgcggagcgtctcttgaaaatgcaaaac
cagcgcggcggccgcgccctcttccaggacgtgcagaagccatctcaagatgagtggggt
aaaacccaggatgctatggaagctgctattgccctggagaagaacctgaaccaggccctt
ttggatctgcatgccctgggttctgcccgcgcagacccacatctctgtgacttcctggag
aaccacttcctggatgaggaggtgaaactcatcaagaagatgggcgaccacctgactaac
ctccgcaggctctctggtccccaggctggtctgggcgagtatctcttcgaaaggctcacc
ctcaagcacgactag

DBGET integrated database retrieval system