KEGG   Camelus ferus (Wild Bactrian camel): 102519655Help
Entry
102519655         CDS       T02979                                 

Gene name
TIAM1
Definition
(RefSeq) T-cell lymphoma invasion and metastasis 1
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr04014  Ras signaling pathway
cfr04015  Rap1 signaling pathway
cfr04024  cAMP signaling pathway
cfr04062  Chemokine signaling pathway
cfr04530  Tight junction
cfr04810  Regulation of actin cytoskeleton
cfr05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102519655 (TIAM1)
   04015 Rap1 signaling pathway
    102519655 (TIAM1)
   04024 cAMP signaling pathway
    102519655 (TIAM1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102519655 (TIAM1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102519655 (TIAM1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102519655 (TIAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102519655 (TIAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tiam_CC_Ex RhoGEF PH RBD PH_9 PDZ PDZ_2 PDZ_6 PH_11
Motif
Other DBs
NCBI-GeneID: 102519655
NCBI-ProteinID: XP_006187563
LinkDB All DBs
Position
Un
AA seq 1591 aa AA seqDB search
MGNAESQNVVHEFYGEKHASLGRKHTSRSLRLSHKARRTRHASSGKAIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQEGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTA
ASVQSMPDSEESRLYGDDATYLAAGGRRQHPCTPNGPTFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGMEARASPRQLSACQRANSLGDLYAQKN
SGVAANGGPRSKFTGCCRNLVSDIPDLANHKMPPAAAEEALPYSNYNTLPCRKSHCLSEG
AANPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPP
TGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESD
GRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACAAAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRYRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGT
EAEKKSLEGIFDDTVPDGKREKEMVLPSVHQHNPDCDIWVHEYCTPSWFCLPNNQPALTV
VRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQHYVPKPEEDIYELLYKEIEICP
KVTQHIQIEKSDTASDNYGFSLSSVEEDGVRRLYVNSVKETGLASKKGLKAGDEILEINH
RAAGTLNSAVLKEFLTQPSLGLLVRTHPELEAGAELLESPPHRLDGPADLSESPLAFLTS
NTGHSLCSEQGSSAETAPEEPEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDPSPS
PQDSAGPQLATMRQLTDADKLRKVVCELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPKQQHSSTLESYLIKPIQRILKYPLLL
KELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTTVIWPNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEDWDPFRFRHMIPTEALQVRALASADAEANAMCEIVHVKSESEGRPERVFHLCCSSP
ESRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAISASSPERESQQPPGGGDTDRWVEEQFDLAQYEEQDDIK
ETDILSDDDEFCESAKGAAADGDLRERLQAASISQRERGRRAPDSHASRLAQLKKQAALP
GINGGLESTSEEVIWVRREDFAPSRKLNTEI
NT seq 4776 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgcagaaagtcaaaatgtagtgcacgagttttatggagaaaagcatgccagc
ctggggcgcaagcacacgtcgcgctccctgcgcctctcgcacaaggcgcggcggaccagg
cacgcctcctcggggaaggcgatccacaggaactccgaagtgagcacccggtccagcagc
actcccagcatcccccagtccctggccgaaaatggcctggagcccttctcccaggaaggc
accctagaggacttcgggagccccatttgggtggaccgagtggatatgggcttgagaccc
gtgtcttacaccgattcttccgtcactcccagcgtagacagcagcatcgtcctcacggca
gcctctgtgcagagcatgccagactcggaggagagcaggctttacggggatgacgctaca
tacttggctgcgggaggcaggaggcagcatccctgtacacccaatgggcccactttcatg
gagaccgcgagctttaagaagaaacgctccaaatctgcagacatctggcgggaggacagc
ctggaattctcactctctgatctgagccaagaacatttaacaagcaacgaagaaatcttg
ggttccgccgaggagaaagactgtgaggaggctcgggggatggaagcccgggcgagtccg
cggcagctcagtgcctgtcagcgtgccaattcgctgggggacttgtacgctcagaagaac
tcaggggtggcggcgaacggggggccgaggagcaaatttacaggctgttgtcggaatttg
gtgtctgacattcccgatcttgcaaaccataagatgccaccagctgccgctgaagaggct
cttccgtacagtaattataacacacttccctgtaggaaatctcactgtctttccgaaggt
gccgccaacccgcaaattagccatagcaacagcatgcaaggcagaagagcaaaaacaact
caggatgttaatgcaggtgagggtagcgagtttgccgacagtgggatcgaaggagccacc
accgacacggacctcctgtccaggcgatccaatgccaccaactccagctactcgcccccc
accggccgcgcctttgtgggcagcgacagtggcagcagctccaccggggatgcagcccgc
cagggggtatacgagaacttccgacgggagctggagatgagcaccaccaacagcgagagc
ctggaggaggcgggctccgcacacagcgacgagcagagcagcggcaccctgagctccccg
ggccagtccgacatcctgctcacggccgcgcagggcacggtgcgcaaggcaggcgccctg
gccgtcaagaacttcctggtgcacaagaagaacaagaaggtggagtcggccacccggagg
aagtggaagcactactgggtgtccttgaaagggtgcacgctctttttctacgagagtgac
ggcaggtccggcatagaccacaacagcatccccaagcacgccgtctgggttgagaacagc
atcgtgcaggccgtgccggagcaccccaagaaggacttcgtcttctgcctcagcaactcc
ctgggcgatgccttcctctttcagaccaccagccagacggagctggagaactggatcacc
gccatccactctgcctgtgcagccgctgtcgcaagacaccaccacaaagaagacacgctc
cgactcctgaagtcagaaatcaaaaaactggaacaaaagattgacatggatgaaaagatg
aagaaaatgggtgagatgcagctgtcttcagtcaccgattcaaagaagaagaaaactatt
ttagatcagatcttcgtttgggagcaaaacctggaacagttccaaatggacctatttcgt
taccgctgctatttagctagtctccagggtggggagctgccgaaccctaaaaggctactt
gcttttgcaagtcggccaacgaaagtggcaatgggccgccttggaatcttttctgtgtca
tcttttcatgccctggtggccgcacgcactggtgaaactggagtcagaagacgtactcag
gccatgtccagatctgcaagcaagcgaaggagcaggttttcttctctttggggtctggac
actacctccaaaaagaagcagggacgcccaagcatcaatcaggtgttcggtgagggaact
gaggctgaaaagaaatctttagagggaatatttgatgacactgttccagatggcaagagg
gagaaagaaatggtcttacccagcgtccaccagcacaaccctgactgtgacatttgggtc
cacgagtactgcactccatcctggttctgtctgccaaataatcagccagccctgaccgtc
gtccggcctggggacacggcccgggacaccctggagctgatctgcaagacacatcagctg
gatcattccgctcattacctgcgcctgaaatttctaatagaaaacaaaatgcagcactac
gtcccaaagcccgaggaggacatttacgagctgctgtacaaagaaattgaaatctgtcca
aaagtcactcagcacatccagattgagaagtcagatacagccagtgataattatgggttt
tcactttcttctgtggaagaagatggtgtccgaaggctctacgtgaacagtgtgaaggaa
actggcttagcttccaagaaaggcctgaaagcgggagacgagattctcgagatcaatcat
cgcgctgccggcaccctgaactcagccgtgctcaaagagttcctcacgcagccgtccctg
ggccttctggtgaggacccaccccgagctggaggcgggagccgagctgctggagagccca
ccccaccggctggacgggcccgccgacctcagcgagagccccctcgcctttctcaccagc
aacacagggcacagcctctgcagcgagcagggcagcagtgccgagaccgctccggaggag
cccgaggggccagacttggaatcctcagatgagactgatcacagcagcaagagcacagaa
caggtggccgcattttgccgcagtctgcatgagatgaacccctctgacccgagcccgtcc
ccccaggactccgcgggacctcagttggccaccatgagacagctcacggatgccgataag
ctgcgcaaggtggtctgtgagctcctggagacggagcgcacctacgtgaaggacttaaac
tgtctcatggagagatacctaaaacctcttcagaaagaaacttttctcacccaagatgag
cttgatgtgctctttggaaatttaactgaaatggtagagtttcaagtcgaattccttaag
actctagaagatggagtgagattggtacctgatttggaaaaacttgagaaagttgatcaa
tttaagaaagtgctgttctctctggggggatcctttctgtattatgctgaccgcttcaag
ctctacagtgccttctgcgccagccacacgaaggtccccaaggtcctggtgaaagccaag
acggacacggctttcaaggcgttcttagatgcccagaacccgaagcagcagcactcgtcc
actctggagtcttacctcatcaagcccatccagaggatcctcaagtacccactgctgctg
aaggagctttttgccctgacggacgcggagagcgaggagcactaccacctggacgtggcc
atcaagacaatgaataaggttgcaagtcacatcaatgaaatgcagaagatccatgaggag
ttcggggctgtgtttgaccagctgattgctgaacagacgggtgagaaaaaagaggttgca
gatctgagcatgggggacctacttttgcacaccaccgtgatctggccaaacccaccagcc
tcgctgggaaagtggaaaaaggaaccagaattggcagcttttgtcttcaaaactgctgtg
gtccttgtatataaagatggttccaaacagaagaagaaactggtaggatctcacaggctt
tcaatttacgaggactgggacccctttcgatttcgacacatgattcctaccgaagctttg
caggttcgagctttggcaagtgcagatgcagaagcaaatgccatgtgtgaaattgtccac
gtaaagtcggagtctgaagggaggccagagagggtcttccacctgtgctgcagctcccca
gagagccgaaaggatttcctgaaggctgtgcactccatcctgcgtgacaagcacagaaga
cagctcctcaagactgagagccttccctcgtcccagcaatatgtcccttttggaggaaaa
cgattgtgtgcgctgaaaggggccaggccagccatgagcagggcagtgtccgccccaagc
aagtctcttgggaggaggaggcggcgactggctcgaaacaggtttaccattgattccgat
gccatctccgccagcagcccggagagagagtcccagcagccgcccggtggcggggacact
gaccgatgggtagaggaacagtttgatcttgctcagtatgaggagcaagatgacatcaag
gagacagacatcctcagtgacgatgatgagttctgtgagtcggcgaagggcgccgccgcc
gacggagacctgcgggagcggcttcaggccgcctccatcagccagcgggagagaggccgc
agagccccggacagtcacgcgtcccgcctggcgcagctcaagaagcaagccgccctgccg
ggcatcaatggaggcctggagagcacgagcgaggaggtcatttgggttaggcgtgaagac
tttgccccctcccggaaactgaacactgagatctga

DBGET integrated database retrieval system