KEGG   Camelus ferus (Wild Bactrian camel): 102520048
Entry
102520048         CDS       T02979                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src isoform X1
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr01521  EGFR tyrosine kinase inhibitor resistance
cfr01522  Endocrine resistance
cfr04012  ErbB signaling pathway
cfr04015  Rap1 signaling pathway
cfr04062  Chemokine signaling pathway
cfr04137  Mitophagy - animal
cfr04144  Endocytosis
cfr04360  Axon guidance
cfr04370  VEGF signaling pathway
cfr04510  Focal adhesion
cfr04520  Adherens junction
cfr04530  Tight junction
cfr04540  Gap junction
cfr04611  Platelet activation
cfr04613  Neutrophil extracellular trap formation
cfr04625  C-type lectin receptor signaling pathway
cfr04727  GABAergic synapse
cfr04750  Inflammatory mediator regulation of TRP channels
cfr04810  Regulation of actin cytoskeleton
cfr04912  GnRH signaling pathway
cfr04915  Estrogen signaling pathway
cfr04917  Prolactin signaling pathway
cfr04919  Thyroid hormone signaling pathway
cfr04921  Oxytocin signaling pathway
cfr04926  Relaxin signaling pathway
cfr05100  Bacterial invasion of epithelial cells
cfr05135  Yersinia infection
cfr05152  Tuberculosis
cfr05161  Hepatitis B
cfr05163  Human cytomegalovirus infection
cfr05167  Kaposi sarcoma-associated herpesvirus infection
cfr05168  Herpes simplex virus 1 infection
cfr05203  Viral carcinogenesis
cfr05205  Proteoglycans in cancer
cfr05219  Bladder cancer
cfr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102520048 (SRC)
   04015 Rap1 signaling pathway
    102520048 (SRC)
   04370 VEGF signaling pathway
    102520048 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102520048 (SRC)
   04137 Mitophagy - animal
    102520048 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102520048 (SRC)
   04520 Adherens junction
    102520048 (SRC)
   04530 Tight junction
    102520048 (SRC)
   04540 Gap junction
    102520048 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102520048 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102520048 (SRC)
   04613 Neutrophil extracellular trap formation
    102520048 (SRC)
   04625 C-type lectin receptor signaling pathway
    102520048 (SRC)
   04062 Chemokine signaling pathway
    102520048 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102520048 (SRC)
   04915 Estrogen signaling pathway
    102520048 (SRC)
   04917 Prolactin signaling pathway
    102520048 (SRC)
   04921 Oxytocin signaling pathway
    102520048 (SRC)
   04926 Relaxin signaling pathway
    102520048 (SRC)
   04919 Thyroid hormone signaling pathway
    102520048 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    102520048 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102520048 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    102520048 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102520048 (SRC)
   05203 Viral carcinogenesis
    102520048 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    102520048 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102520048 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102520048 (SRC)
   05152 Tuberculosis
    102520048 (SRC)
   05100 Bacterial invasion of epithelial cells
    102520048 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102520048 (SRC)
   05168 Herpes simplex virus 1 infection
    102520048 (SRC)
   05163 Human cytomegalovirus infection
    102520048 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102520048 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102520048 (SRC)
   01522 Endocrine resistance
    102520048 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfr01001]
    102520048 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfr04131]
    102520048 (SRC)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102520048 (SRC)
Protein kinases [BR:cfr01001]
 Non-receptor tyrosine kinases
  SRC family
   102520048 (SRC)
Membrane trafficking [BR:cfr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    102520048 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    102520048 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    102520048 (SRC)
  Macropinocytosis
   Kinases
    102520048 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 102520048
NCBI-ProteinID: XP_032318169
LinkDB
Position
19
AA seq 553 aa
MGSNKSKPKDASQRRRSLEPAENTHSGGGGAFPTSQTPSKPASADGHRGPNTAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKV
DVSQTWFTFRWLQREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESER
LLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQF
SSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGE
VWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEY
MNKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVC
KVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGR
VPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYF
TSTEPQYQPGENL
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagcct
gccgagaacacccacagcggtggcgggggtgccttccccacctcacagacccccagcaag
ccggcctctgctgatggccaccgcggccccaacacggcctttgcgcctgcggccgccgag
cccaagctgtttggaggcttcaactcctcggacacagtcacctccccgcagagggcgggg
cccctggctggtggcgtgaccacctttgtggccctctatgactacgagtcacggacagag
actgacctgtctttcaagaaaggggagcggctccagattgtcaacaacacgaggaaggtg
gatgtcagccagacctggttcacattcagatggctgcaaagagagggagactggtggttg
gctcactcgctcagcacaggacagacgggctacatccccagcaactatgtggcgccctct
gactccatccaggccgaggagtggtattttggcaagatcaccagacgggagtcagagcgg
ttactgctcaatgcggagaaccccagagggaccttcctagtgcgagaaagcgagaccaca
aaaggcgcctactgcctctcagtgtccgacttcgacaacgccaagggcctcaatgtgaag
cactacaagatccgcaagctggacagcggtggcttctacatcacctcccgcacccagttc
agcagcctgcagcagctcgtggcctactactccaaacacgctgatggcctgtgtcaccgc
ctcaccaccgtgtgccccacatccaagccacagactcagggtctggccaaggatgcctgg
gagatcccccgggagtctctgcggctggaggtcaagctgggccagggctgcttcggagag
gtgtggatggggacctggaacggcaccacgagggtggccatcaaaaccctgaagcccggc
acaatgtctccggaggccttcctgcaggaggcccaggtcatgaagaaactgaggcatgag
aaactggtgcagctgtacgcggtggtgtccgaggaacccatctacattgtcacggagtac
atgaacaaggggagtttgctggactttctcaagggagagacaggcaagtacctgcggctg
ccccagctggtggacatggctgctcagattgcctcaggcatggcgtatgtggagcggatg
aactatgtccaccgagacctccgtgctgccaacatcctggttggagaaaacctggtgtgc
aaagtggctgacttcgggctggcccggctcattgaagacaacgaatacacagcccggcaa
ggtgccaaattccccatcaagtggacggctccagaagccgcgctctacggccggttcacc
atcaagtccgatgtgtggtcctttgggatcctgctgacagagctcacaactaagggacgg
gtgccctaccctgggatggtgaaccgcgaggtgctggaccaggtggagcggggctaccgg
atgccctgcccgcctgagtgtcccgagtctctgcatgacctcatgtgccagtgctggcgg
aaggacccggaggaacggcccaccttcgagtacctgcaggccttcctggaggactacttc
acgtccactgagccccagtaccagcccggagagaacctatag

DBGET integrated database retrieval system