KEGG   Camelus ferus (Wild Bactrian camel): 102521823Help
Entry
102521823         CDS       T02979                                 

Gene name
TGM2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    102521823 (TGM2)
Enzymes [BR:cfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102521823 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 102521823
NCBI-ProteinID: XP_006188686
UniProt: S9WQ82
LinkDB All DBs
Position
Un
AA seq 687 aa AA seqDB search
MAEDLVLERCDLELEANGRDHHTAELCRERLVVRRGQLFRLTLHFEGRSYEASVDSLTFS
AVTGPAPSEEAGTKARFRLSDAVEEGAWAAAVVDQQDGALSLQLSTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFTLLFNTWCPADAVYLDLEEERREYVLTQQGFIYQGSAKFIKNIPW
NFGQFEDGILDICLMLLDINPKFLKDAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMFWIGSVDILRRWKNYGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIESDKSEMIWNFHCWVESWMDRPDLKPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVIDWIRQDDGSVHKSINHSL
VVGLKISTKSVGRDDREDITHTYKYPEGSPEEREAFTRANHLNKRADKEETGVAMRIRVG
QDMNLGSDFDVFAHVTNNTTEEHTGRLLLCARTVSYNGILGPECGTKDLLNFSLEPFSEK
SIPLRILYEKYCDCLTESNLIKVRGLLIEPAANSYLLAERDIYLENPEIKIRILGEPKQN
RKLVAEVSLRNPLTVPLSGCAFTVEGAGLTEEQKVVEIPDPVEAGEEVKVRVDLLPMNVG
RHKLVVNFESDRLKAVKGFRNVIVGPS
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggatctggttctggagagatgcgacctggagctagaggccaatggccgtgat
caccacacagccgaactgtgcagggagaggctggtggtgcggcgtggccagctcttccgg
ctgacgctgcacttcgagggccggagctatgaggccagcgtggacagcctcaccttcagt
gctgtgaccggcccagcccccagcgaggaggccgggaccaaggcccgcttcaggctgtct
gatgctgtagaagagggtgcctgggcggccgcagtggtggaccagcaagacggcgccctc
tcgctgcagctcagcaccccggccaatgcccccatcggtctgtaccgtctcagcctggag
gcctccaccggctaccagggctccagcttcgtgctaggtcacttcaccctgctcttcaac
acctggtgcccagcggacgctgtgtacctggacttggaagaggagcggcgggagtacgtc
cttacccagcagggcttcatctaccagggctcagccaagttcatcaagaacataccttgg
aattttgggcagtttgaagacgggatcctggacatctgcctgatgctcctggacatcaac
cccaagttcctgaaggacgccggccgtgactgctcccgccgcagcagcccggtctacgtg
ggccgggtggtgagcggcatggtcaactgcaacgatgaccagggtgtgctgctaggacgc
tgggacaacaactatggggacggcgtcagccccatgttctggattggcagtgtggacatc
ctgcggcgctggaagaactacggctgccagcgtgtcaagtatggccagtgctgggtcttc
gctgccgtggcctgcactgtgctccggtgcctcggcatcccgactcgcgtcgtgaccaac
tataactcggcccatgaccagaacagcaacctgctcatcgagtacttccgcaacgagttc
ggggagatcgagagtgacaagagcgagatgatctggaacttccactgttgggtggagtcg
tggatggacaggccagacctaaagccggggtatgaaggatggcaggccctcgaccccacg
ccccaggagaagagtgaagggacatactgctgcggccctgttcccgttcgtgccatcaag
gagggcgacctgagcaccaaatacgacgcccctttcgtctttgctgaggtcaacgctgac
gtgatagactggatccggcaggatgatgggtctgtgcacaagtccatcaaccactctctg
gtcgtggggctgaagatcagcacgaagagtgtgggcagagacgacagggaggacatcacc
cacacctacaagtacccagagggatccccagaggagagggaagccttcaccagggccaac
cacctgaacaagcgtgctgataaagaggagacgggggtagccatgcgaatccgtgtgggc
caggacatgaacttgggcagcgactttgacgtctttgcccacgtcaccaacaacaccacc
gaggagcacacaggccgcctcctgctctgtgcccgcactgtcagctacaacgggatcctg
ggccccgagtgtggcaccaaagacctactcaacttttccctggagcccttctccgagaag
agcattccccttcgcatcctctacgaaaagtactgtgactgcctgaccgagtcgaatctc
atcaaggtgcggggccttctcatcgagccagctgccaacagctacctgctggccgagaga
gacatctacctggagaatccagaaatcaagatccggatcctgggagagcccaagcagaac
cgcaagctggtggctgaggtgtcgctgcggaacccacttacggtgcccctatctggctgc
gccttcactgtggagggggcaggcctgaccgaggagcagaaggtggtggagatcccggac
cctgtggaggcaggggaggaagtcaaggtgagggtggacctgctgcccatgaatgtgggc
cgccacaagctggtggtgaactttgagagcgacaggctgaaggcagtgaagggcttcagg
aacgtcatcgtcggcccttcctaa

DBGET integrated database retrieval system