KEGG   Collimonas fungivorans: CFU_0032Help
Entry
CFU_0032          CDS       T01583                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cfu  Collimonas fungivorans
Brite
KEGG Orthology (KO) [BR:cfu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CFU_0032 (ahpF)
Enzymes [BR:cfu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CFU_0032 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO FAD_binding_3 NAD_binding_8 AlaDh_PNT_C Thi4 K_oxygenase Glutaredoxin Lycopene_cycl FMO-like
Motif
Other DBs
NCBI-ProteinID: AEK59871
UniProt: G0A7W0
LinkDB All DBs
Position
complement(50806..52416)
Genome map
AA seq 536 aa AA seqDB search
MQGTAMLDANLKTQLKSYLEKIVQPIEIVASLDNGDKSRELQSLLQEIATLSDHITLIER
SDDNERKPSFSINRPGVDTGIRFAAIPMGHEFTSLVLALLQVGGHPVKLDEAVIEQIRNL
DGDYVFETYISLSCQNCPEVVQALNVMALINPRIRQATIDGALFQDEVEKREIMAVPTTY
LNGEVFGQGRTSVEEILAKLDTGAGARKAVELSAKAPYDVLIVGGGPAGAAAAIYAARKG
IRTGVVSERFGGQVLDTLAIENFVSVKETEGPKFATALEQHVKSYEVDIMNVQLASELVP
GKLIEIKLANGGSLKSKTVVLATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVA
VIGGGNSGVEAAIDLAGLVSHVTLIEFGDELRADAVLQRKLHSLKNVTVITSAQTTEITG
DSKKVNGLVYKDRKTDAVHKVELEGVFVQIGLVPNTEWLKGTIALSRHGEIEVDAKGQTS
IPGVFAAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRSSVSDEEDVAAAAETVAA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggaaccgccatgctggatgcaaatctcaaaacccaattgaaaagctacttggaa
aaaatcgtgcaaccgattgagatcgttgcgtcgctggacaatggtgacaagtctcgtgaa
ctgcaatcgctgttgcaggaaatcgccacgctgtcggatcacatcacgctgatcgagcgc
agcgacgacaatgaacgcaaaccgtcgttctccatcaatcgcccaggcgtcgataccggc
atccgttttgccgcgattccgatgggccacgaattcacttcgctggtgctggccctgctg
caggtcggcggccatccggtcaagctggacgaggccgtgatcgagcagatccgcaacctg
gatggcgattacgtgttcgaaacctatatctccctctcctgccagaactgccctgaagta
gtgcaggccctgaacgtgatggcgctgatcaatccgcgcatccgccaggccaccatcgac
ggcgcactgttccaggacgaagtggaaaaacgcgaaatcatggccgtgccaaccacttac
ctgaacggtgaagtgttcggccaaggccgcaccagcgtcgaagaaatcctcgccaagctg
gataccggcgccggcgcccgcaaggcagtcgaactgagcgccaaggcgccttacgatgtg
ctgatcgtcggcggcggtcctgccggcgcggcggctgcgatttatgcagcacgcaagggt
atccgcaccggcgtggtgtcggagcgtttcggcggccaggtgctggatacgctggcgatc
gagaacttcgtctccgtcaaggaaaccgaaggaccgaaattcgccaccgcgctggaacag
cacgtcaagagctatgaagtcgacatcatgaacgtgcagctggcctccgagctggtgccg
ggcaagctgatcgaaatcaagctggccaacggcggttcgctcaagagcaagaccgtggtg
ctggccaccggcgcccgctggcgcgaaatcaacgtgccgggcgaacgcgaataccgtaac
cacggcgtcgcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcg
gtgatcggcggcggcaactccggcgtcgaagcagcaatcgacctggccggcctggtgtcg
cacgtgacgctgatcgaattcggcgatgaattgcgcgccgatgcggtgctgcaacgcaag
ctgcacagcctgaaaaacgtcaccgtgatcacttcggcccaaaccaccgaaatcaccggc
gacagcaagaaggtcaacggcctggtctacaaggaccgtaagaccgatgccgtgcacaag
gtcgagctggaaggcgtgttcgtgcagatcggcctggtgccgaacaccgaatggctgaag
ggcacgatcgcgctgtcgcgccacggcgaaatcgaagtcgacgccaagggccagacctcg
attcccggcgtgttcgccgccggcgacgtcaccaccgtgccgttcaagcagatcgtgatc
gcggtcggcgaaggcgccaaggcatcactgagcgcattcgaccacctgatccgcagttcg
gtgtcggatgaagaagacgtcgctgccgcggccgagactgtcgctgcgtag

DBGET integrated database retrieval system