KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg0124
Entry
cg0124            CDS       T00244                                 

Gene name
amn
Definition
(GenBank) AMP NUCLEOSIDASE
  KO
K01241  AMP nucleosidase [EC:3.2.2.4]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00230  Purine metabolism
cgb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    cg0124 (amn)
Enzymes [BR:cgb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.4  AMP nucleosidase
     cg0124 (amn)
SSDB
Motif
Pfam: AMNp_N PNP_UDP_1
Other DBs
NCBI-ProteinID: CAF18663
LinkDB
Position
103480..104913
AA seq 477 aa
MQKDSVVRMEATTIDDAIAKLIDIYDTSTKLAKETLNNEDYAAYADVVYPKLTVDVLEWK
PIDRTEPFGYVDRAGRYSATLSKPRVIERYLREQLERLTSNYPCKIYVSESDIRIPPEYI
RGAPSATEARRAGDVADIIPRPTLDEVHDAIIDGDWHAFNGPELPLFHFGPQRFDIACAR
IEHYTGINVEHVQKYILFTNYAMHTTEFVHFAMSELTSEDSRYVGLSLPNGQVIDRETAT
SLGTETLDLTSRFQMPRYDLITEAGDGITIINIGVGPSNAKTITDCLAVLRPEAWVMIGH
CAGMDARMRIGDLILGNAYQREDHILNTRIPLGNPIPAIPEIQKALEASVDEIYGSDNSL
MRTGTVLSTDDRNWEWHTPENLWNWLKGSTAAAVDMESSTLATNGYRYRIPYGTLLSVSD
LPLHAVPKLPAQAQAFYSNSKEAHVMCAVRAMEYLAVDPERLRTRKLRRTLGEVPFR
NT seq 1434 nt   +upstreamnt  +downstreamnt
gtgcagaaagatagtgtggtgcgcatggaagcaacaacgatcgatgacgcaatcgcgaag
ctcattgacatctacgacacctcgaccaaactggccaaagaaaccctcaacaatgaggac
tacgccgcatacgccgatgttgtttaccccaaactcaccgttgacgtgctggaatggaaa
cccatcgaccgcaccgaacccttcggctatgtggatcgagccgggcgatactccgccacc
ttgtccaaaccacgcgtgattgagcgttacctccgcgaacaactcgagcgtctcaccagt
aattatccctgcaagatttacgtatctgagtcagatatccgcatcccaccggagtacatt
cgcggcgcaccttccgctaccgaagctcgccgtgctggtgatgttgcagatatcatccca
cgccccaccctggatgaagtccacgacgcaattatcgacggcgactggcacgccttcaac
ggccccgaactcccgcttttccacttcgggccgcaacgcttcgacatcgcctgcgcccgc
atcgagcactacaccggcatcaacgtggaacacgtgcagaagtacattctgttcaccaac
tacgccatgcacaccaccgagttcgtgcattttgccatgtccgaactcacctcggaagac
tcccgctacgtgggtctatccttgccaaacgggcaggtaattgaccgagagaccgccacc
agcctcggtacggaaacccttgatctgactagccgtttccaaatgcctcgttacgatctc
atcaccgaagccggtgacggtattaccattatcaacatcggtgtgggcccatccaatgca
aaaactatcaccgactgccttgctgtgctccgcccagaagcctgggtgatgatcggccac
tgtgctggcatggacgcccgcatgcgcatcggcgacctcatccttggcaacgcctaccag
cgcgaagaccacattctgaatacccgcatcccacttggtaatccgatcccggcaatacca
gaaatccaaaaagctctagaagccagcgtcgacgaaatctacggatccgacaacagcctc
atgcgcaccggtacggtcttatccaccgacgaccgaaactgggaatggcacaccccagaa
aacctctggaactggctcaaaggatccaccgccgcagctgttgacatggaatcttccacc
ttggccaccaacggatatcgataccgcattccatacggcaccctgctgagcgtctctgac
ctgccactacacgcagtgccgaaacttcccgcgcaagcgcaggcgttttactccaactcc
aaggaagcccacgtcatgtgtgctgttcgtgcaatggaatacctggcagtagatcctgaa
cggttgcgtacccgtaaactgcgcaggaccttgggtgaggtgccgtttcgctaa

DBGET integrated database retrieval system