KEGG   Cricetulus griseus (Chinese hamster): 100759349Help
Entry
100759349         CDS       T02813                                 

Gene name
Napepld
Definition
(RefSeq) N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D isoform X1
  KO
K13985  N-acyl-phosphatidylethanolamine-hydrolysing phospholipase D [EC:3.1.4.54]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:cge00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100759349 (Napepld)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.54  N-acetylphosphatidylethanolamine-hydrolysing phospholipase D
     100759349 (Napepld)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B_3 Lactamase_B
Motif
Other DBs
NCBI-GeneID: 100759349
NCBI-ProteinID: XP_027249230
LinkDB All DBs
Position
1
AA seq 402 aa AA seqDB search
MCFSPKDMDENENSQSSTTSYQYPKETVRKRQNSVQNSGGSVSSRFSRKSFKLDYRLEED
VTKSKKGKDGRFVNPWPTWKNISISNVFRWLIMEKDHSSVPVSKEELDKELPVLKPYFIS
DPKEAGVTEAGLRVTWLGHATLMVEMDELIFLTDPMFSSRASPSQYMGPKRFCGPPCTIS
ELPPIDAVLISHNHYDHLDYGSVLALNERFGSELRWFVPLGLLDWMQKCGCENVIELDWW
EENCVPGHDKVTFVFTPSQHWSKRTLMDDNKVLWGSWSVLGPWNRFFFAGDTGYCPAFEE
IGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEDAVRIHIDVQTKKSVAIHWGTFALANEH
YLEPPVKLNEALERYGLKSEDFFVLKHGESRYLNNDKAFEET
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttctcaccaaaggacatggatgaaaatgaaaacagtcagtcttcaactacaagc
tatcaatatcctaaagaaacagtaaggaagcgccaaaattcagtacagaattcaggagga
agtgtgtcttctaggttttccaggaaaagcttcaaactggattatagactagaagaagac
gtaactaaatcgaagaaaggaaaagatgggagatttgttaacccatggccgacatggaaa
aacatctctatctcaaatgtttttagatggctgataatggagaaagaccacagcagtgtt
ccggtttccaaagaggaacttgacaaagaactcccagtgcttaagccatattttatcagt
gaccccaaagaagctggagtgacagaggctggcttgagagtcacatggttgggacacgca
acgctgatggtggagatggatgagctcatattccttacagatcccatgtttagttcccgg
gcctctccctcacagtacatgggtccaaagcggttttgcggtcccccgtgtacaataagt
gaactccccccaatagatgctgttcttattagtcacaaccactacgaccacctggactat
ggctctgtcctcgctttgaatgagcgctttggcagtgagctgagatggtttgtgcctctg
gggcttctcgactggatgcagaaatgtggctgtgagaacgtgattgagctggactggtgg
gaggagaattgcgtccctggccatgataaggtcacctttgtcttcacaccttcccaacac
tggagtaaaaggaccctcatggatgacaacaaggttctgtggggcagctggtctgtgttg
gggccttggaatcgattcttctttgcgggggatactggttactgccctgcgtttgaagag
ataggaaagaggtttggtccctttgacctggcagctattcccattggagcttatgagcca
aggtggtttatgaaataccagcatgtagacccagaagatgctgtaaggattcatattgat
gttcaaaccaagaaatctgtggcaattcactggggaacgtttgccttagctaatgagcat
tacttagaacctccagtgaaactgaatgaagctctagaaagatatggacttaaaagtgaa
gatttctttgtcctgaagcacggcgaatcaagatacttgaataatgataaagcttttgaa
gaaacatga

DBGET integrated database retrieval system