KEGG   Corynebacterium glutamicum SCgG1: C624_02365Help
Entry
C624_02365        CDS       T02690                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
cgs  Corynebacterium glutamicum SCgG1
Pathway
cgs00061  Fatty acid biosynthesis
cgs00071  Fatty acid degradation
cgs01100  Metabolic pathways
cgs01212  Fatty acid metabolism
cgs02024  Quorum sensing
Module
cgs_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:cgs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C624_02365
   00071 Fatty acid degradation
    C624_02365
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C624_02365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cgs01004]
    C624_02365
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgs04147]
    C624_02365
Enzymes [BR:cgs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     C624_02365
Lipid biosynthesis proteins [BR:cgs01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   C624_02365
Exosome [BR:cgs04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   C624_02365
  Exosomal proteins of breast cancer cells
   C624_02365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AGN18062
LinkDB All DBs
Position
complement(509925..511631)
Genome map
AA seq 568 aa AA seqDB search
MSAYETKEWLQHYPEWTPHSLEYGDTTLLDVYDNNLAINADKPATYFFGRSQTYGELDKE
VRKTAAGLRALGVRPGDHVAIILPNCPQHIAAFYAVLKLGAVVIEHNPLYTAHELLEPFK
DHGARVAIVWDKASPTVEQLRGQTQLETIVSVNMINAMPPLQRLALRLPIPALRKSRESL
SGAAPNTVPFETLTSAAMGGDGDDVVSEPTVTKESVALILYTSGTTGRPKGAQLTHGNLF
SNLLQGKHWVPGLGDKPERMLAALPMFHAYGLTMVGTLSVFIGGEMVLLPTPRIDLIMNV
MKKHTPTWLPGVPTLYEKIVDASEKEGIPIKGVRNAFSGASTLSQRTVERWEKHTGGRLV
EGYGLTETSPIIVGNPMSDHRRQGYVGIPFPDTIVRIANPENLDETMPDGSEGEVLVKGP
QVFKGYLNQEEATKNSFHGEWYRTGDVGVMEEDGFIRLVARIKEVIITGGFNVYPAEVEE
VLAEHPDIEDSAVVGIPREDGSENVVAAITLVEGAALDPDGLKEFARKNLTRYKVPRTFY
HFEEMPRDQMGKIRRREVQAELLKKLGK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcatacgaaaccaaagaatggctccagcactacccagagtggacgccacactcg
ctggaatatggcgacaccaccctgctggacgtttacgacaacaacctggccatcaacgca
gacaagccagccacctactttttcggtcgttcacaaacctacggtgaactggacaaagaa
gtccgcaaaactgccgctggcctgcgcgcactaggtgtccgccccggcgatcacgtagcg
attatcctccccaactgcccccagcacatcgccgctttctacgcagtgctgaaacttggc
gcagtagtcattgagcacaacccgctctacaccgcccacgaactgctcgaacccttcaaa
gaccacggtgcccgcgttgccatcgtctgggacaaagcctcccccaccgtcgagcagctt
cgtggacaaacccagttggaaaccatcgtgtccgtgaacatgatcaacgcgatgccacca
ctccagcgcctagcacttcggctcccaatccctgcactgcgcaagagccgcgaatccctc
tccggcgcagcccctaacaccgttccttttgaaaccctaaccagcgcagcaatgggcggc
gacggcgacgacgtagtttcagaacccaccgtgaccaaagaatccgtcgcgctgatcctc
tacacctccggcaccaccggacgccccaagggtgcccagctcacccacggaaacctgttc
tccaatctcctccaaggaaagcactgggttccaggtctcggagacaaaccagaacgcatg
cttgcagccctaccaatgttccacgcatacggtctgaccatggtcggcacactgtccgtg
ttcatcggtggcgaaatggtgctacttcccaccccacgcatcgacctgatcatgaacgta
atgaaaaagcacaccccaacctggctaccaggcgtgcccaccctttacgaaaaaatcgtc
gacgcctccgaaaaagaaggaatccccatcaagggagtccgcaacgccttctccggtgca
tccacactctcccagcgcaccgttgaacgctgggaaaagcacaccggcggacgtctcgtc
gaaggctacggcctcaccgaaacctcccccatcatcgtgggtaaccccatgagcgatcac
cgacgccaaggctacgtaggaatccccttccccgacaccatcgtgcgcatcgcaaaccca
gaaaacctcgacgaaaccatgccagacggcagcgaaggcgaagtcctagtcaagggccca
caggtgttcaagggctacctcaaccaggaagaagccaccaagaacagcttccacggcgag
tggtaccgcaccggcgacgtcggagtaatggaagaagacgggttcatccgcctagttgct
cgcatcaaggaagtcatcatcactggcggtttcaacgtgtacccagctgaggttgaagaa
gttctcgcagagcacccagacattgaagattccgcagtcgttggtatcccgcgtgaagac
ggctccgaaaacgtcgttgctgccatcactttggtggaaggtgcagcgctggatccggat
ggcctgaaggaattcgcccgcaagaacctcacccgctacaaggttccgcgcactttctac
cactttgaggagatgccacgggatcagatgggcaagattaggcgtcgtgaagtgcaggcg
gagctgttgaagaagctcggcaagtag

DBGET integrated database retrieval system