KEGG   Corynebacterium glyciniphilum: CGLY_10510Help
Entry
CGLY_10510        CDS       T03073                                 

Gene name
bdhA
Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cgy  Corynebacterium glyciniphilum
Pathway
cgy00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CGLY_10510 (bdhA)
Enzymes [BR:cgy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CGLY_10510 (bdhA)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CGLY_10510 (bdhA)
    1.1.1.-  
     CGLY_10510 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C 2-Hacid_dh_C DZR FAD_binding_3 AdoHcyase_NAD Pyr_redox zf-ribbon_3 Prok-RING_1
Motif
Other DBs
NCBI-ProteinID: AHW64547
UniProt: X5DV68
LinkDB All DBs
Position
complement(2252851..2253948)
Genome map
AA seq 365 aa AA seqDB search
MRAARFYDRGDIRVEDIDPQPLEFGTARIDVAWCGICGTDLHEYLDGPIFCPACGKPHPI
SGEDAPVTLGHEFSGVVSEVGEGIDDLAVGDHVVVEPYIIADDVDTGPDSTTYHLSENMN
FIGLAGRGGGLSENVVVRRRWIHKISDSVPLDQAALIEPLSVGYHAVERSGLSADGASPA
GKTALIGGAGPIGLLTAAVLKALGVRVVMSELSELRRQKALDAGVADVVLNPSEVDVVAE
VATLTDGVGADVAFECTSVQVVLDTLMDALRPTGVLVVVSIWGHRSEFDMHKLVMKELDV
RGTIGYVNSHPKTIELVESGKIDLSPFITGKIGLDGLVDEGFDTLINRNETAVKILVSPS
GNGID
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagcacgtttctatgaccgcggcgacatcagggtcgaggacatcgacccgcaa
ccgctcgaattcggcaccgcccgcatcgacgtcgcatggtgcggcatctgcggcaccgac
ctccacgagtacctggacgggccgatcttctgtccggcctgtgggaagccgcacccgatc
tccggcgaggatgctccagtcaccctcggccacgagttctccggcgtcgtcagtgaggtc
ggcgaggggatcgacgacctggcggtaggcgatcacgtggtcgtggagccgtacatcatt
gccgacgacgtggacaccggcccggacagcaccacctatcacctctcagagaacatgaac
ttcatcggtctggccggccgcggtggcgggttgtcggagaacgtggtggtgcgccgacgg
tggatccacaagatctctgactccgttcctctggaccaggcggcgttgattgagcccctc
tcggtgggctaccacgctgtcgagcgttccggcctctcggccgacggggcgtccccggca
ggcaagaccgctctcatcggtggcgctggtccgatcggactgctcacggcggctgtgctc
aaagcgctcggggtgcgcgtggtgatgtctgagctctcggaactacgccgccagaaagcc
ctggacgccggcgtcgcggatgtcgtcctgaacccgtcggaggtcgacgtcgtcgccgag
gtcgccacgctcaccgatggcgtgggagcggacgtcgccttcgagtgcacgtccgtgcag
gttgtcctcgacacattgatggacgcgctgcgccccaccggtgtgctggtcgtggtgtcg
atctggggtcacaggtctgagttcgacatgcacaagctggtcatgaaggagctcgacgtg
cggggcacgatcggctacgtcaactctcatccgaagacgattgagctcgtggagtccggc
aagatcgatctgtcgccgttcatcaccggcaagatcggactggacgggttggtggacgaa
ggtttcgacacattgatcaaccggaatgaaaccgcggtcaagatcctggtgtccccctcc
gggaacggcatagactga

DBGET integrated database retrieval system