KEGG   Chromobacterium sp. IIBBL 274-1: DK843_17135
Entry
DK843_17135       CDS       T05744                                 

Gene name
icmF
Definition
(GenBank) type VI secretion system membrane subunit TssM
  KO
K11891  type VI secretion system protein ImpL
Organism
chrb  Chromobacterium sp. IIBBL 274-1
Pathway
chrb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:chrb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    DK843_17135 (icmF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:chrb02044]
    DK843_17135 (icmF)
Secretion system [BR:chrb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   DK843_17135 (icmF)
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: AXE35875
UniProt: A0A344UKS7
LinkDB
Position
3566885..3570667
AA seq 1260 aa
MLHKGWLRNAKVASAIGFLILIALIWWLGPWLGLASVEARLGWIVAVMIVWVLALLIGQA
LAKRAGGLLEGMLRRQADDAVINASADKRAEVTLLRQRLLGAIDTLKKSNLGSARGSAAL
YELPWYMIIGHPAAGKSSAILQSGLTFPFSDKSGIQGVGGTRNCDWFFSTEGVLLDTAGR
YATESEDRTEWLAFLKLLKKHRAKAPVNGIMVAISLPELAQHNSEGFVLYARQVRERIHE
VCNTFGLMVPIYLVFTKLDLLGGFAQFFHDAGEEERSRVWGATLSSDQGTGFDAGAVVAQ
QFEQLYRGLVQMGEEKLVGARGDAVKSAHFAFPIEFHGLQEAVVKFVRILFEEDPYHSRP
LLRGFYFTSALQEGVPRIVTAGRVQGQFDLSSVGMDKHQAPASYSYFLRGLFREVLFPDQ
HLIFQQTRPSGSRWRLAGMAAGLVSLAAVAGLWTWSFVGNQQMVAQVNAERVQAQKLAAS
GQLYDRLSGLLILQRRLEELQTYRRNGEPWQIGLGLYQGEELERNLRKAYFAGLKDVMLS
PVQKNLETTLAALKPGVVQPVTVTEPPKTEAKPEPKPVAKPAPKPYKPRPKHGLPNIQLG
ALELPQRATTAKLDASAPAAGAVAADGTQPQKSQKLDVAYNALKTYLMLHDRRRMEEAHL
ADQLPRYWRPWLESQRGEYPVGEVMAQAEKLVAFYVSQIKEADLPLIDNDVKVVTDARDV
LRGSFKQLSAQERVFNEIKARANTRFAPLTVARILDNRDMDIMASSQMVEGAYTREAWNA
YVRTAIDEASKGTIRSDDWVLASSTQDDLGKDGDVEKNRAALEALYRAQYIAAWHKFLSG
VVVRDITNPAQSASAMTRLSDKQNSPIKLILARAALETSWDNPSELNRSLETAKRSVLEK
TTEFFKSGDAPAAKNEKQFGVVGAHFSGVAALVKGDNSPINGYLDQLAKLKVKMVAITST
DEPGAQARTVLQSTLNGSGSELGDTLSYVDNTLLNGATPDTVEMVRPMLVRPLSQSYSAL
LGPVAQDINQAWANEVLPQWRQLAGKYPFSDSSSSASVADINRFVKANEGTLDKFINKYL
TGLVQKKGDTLVPRAWGNEGVRFNPQFLSGVSSLMALANTQLQDGENSRFELQPLPTPGL
SEIVLSIDGQELRYRNGPQQWQPFNWPGSGSEGARIQVVNYAGASTVVGNQSGRMGLMRL
LAGAKVNVDGDSAAQLTWTLPKGSGAEGQTVRFNFRMLGGVNPLQLNRLYKLTLPERVTL
NT seq 3783 nt   +upstreamnt  +downstreamnt
gtgttacacaaaggttggctacgcaatgccaaggtggcatcggccatcggattcttgatc
ctgatagcgctgatctggtggctggggccctggcttggtttggcgtcggttgaggcgcgc
ctgggctggatcgtcgcggtgatgatcgtatgggttctggcgctgttgatcggccaggcg
ctggccaagcgcgccggcggcttgctggaaggcatgctgcgccgtcaggcagatgacgcg
gtgatcaacgccagcgccgacaagcgggcggaagtgacgctgctgcgtcagcgcttgctc
ggcgcgatcgatacgctgaagaagtccaacctcggcagcgcccgcggcagcgcggcactg
tacgagctgccctggtacatgatcattggtcatcccgcggccggcaaaagctccgccatc
cttcagtccggcctgaccttcccgtttagcgacaagagcggcatccagggggtcggcggc
acgcgcaattgcgactggttcttctccaccgaaggcgtgctgctggataccgctggccgc
tacgcgaccgagagcgaggaccgcaccgagtggctggccttcctcaagctgctgaagaag
caccgcgccaaggcgccggtcaacggcatcatggtggcgatcagcctgccggagctggcc
cagcacaacagcgagggtttcgtgctgtacgcccgccaggtgcgcgagcgcatccacgag
gtgtgcaacactttcggcctgatggtccccatttatctggtcttcactaagctggacctg
ctgggcggcttcgcccagttcttccacgacgctggcgaggaggagcgttcccgcgtatgg
ggcgcgaccttgtcttccgatcaaggcactggcttcgacgccggcgccgtggtggcgcag
caattcgagcagttgtatcgcggcttggtgcagatgggcgaggaaaagctggtgggcgcg
cgcggcgacgcggtgaagtcggcccatttcgccttcccgatcgaattccatggcctgcag
gaggcggtggtcaaattcgtccgcatcttgttcgaagaggatccgtaccattcccgcccg
ttgctgcgcggcttctatttcaccagcgcgttgcaggaaggcgtgccgcgcatcgtgacc
gccggccgtgtgcagggtcagttcgatctatcgtctgtgggcatggacaagcatcaggct
ccggcatcgtacagctacttcctgcgcggtttgttccgcgaagtgctgttcccggaccag
cacctgatcttccagcaaacccgccccagcggcagccgctggcggctggcggggatggct
gccggcctggtgtcgctggcggccgttgccggcttgtggacctggtcatttgtcggcaat
cagcagatggtcgcccaggtaaacgccgagcgcgtccaggcgcagaagctcgccgcttcc
ggccagctctatgaccgcctgagcgggctgctgatcctgcagcgccggttggaggagtta
cagacttaccgccgcaacggcgagccgtggcaaatcgggctgggcctgtatcaaggcgag
gagctggagcggaatctgcgcaaggcctatttcgccggcttgaaggatgtgatgctgagt
ccggtgcagaagaatctggaaaccacgctggcggcgctgaagccgggggtggtgcagccg
gtcaccgtgaccgagcctccgaagacggaagccaagccggagccgaagccggtcgccaag
cctgcgcccaaaccgtacaaaccacggccgaaacatgggctgccgaatatccagctgggc
gcgttggaactaccgcagcgcgcgaccaccgccaaactggacgcctccgcgcctgccgcc
ggagccgtcgcggcggacggcacgcagccgcagaagtcgcagaagctggatgtcgcctac
aacgcgctgaaaacttatctgatgctgcatgaccgtcgtcggatggaagaggcgcacctg
gctgaccaactgccgcgctactggcgtccatggctggaaagccagcgcggcgaatacccg
gtcggcgaagtgatggctcaggccgagaaactggtggcattctacgtcagccagatcaag
gaagcggatttgccgctgatcgacaatgacgtcaaggtcgtgaccgacgcgcgcgacgtg
ttgcgcggctcgttcaagcagttgtccgcccaggagcgcgtgttcaacgagatcaaggcg
cgcgccaatacccgcttcgcgccgctgacggtggcccgcattctggacaaccgcgacatg
gacatcatggccagcagccagatggtggagggcgcctatacccgcgaggcgtggaatgcc
tatgtccgcaccgccatcgacgaggccagcaagggcaccatccgcagcgacgactgggtg
ctggcctccagcacccaggacgatctgggcaaggacggcgacgtggagaagaaccgcgcc
gcgctggaggcgctgtaccgcgcgcagtacatcgccgcctggcacaagttcctgtccggc
gtggtggtccgcgacatcaccaacccggcgcagtccgcgtcggcgatgacccgcctgtcc
gacaagcagaattctccgatcaagctgattctggcgcgggcggccctggaaacctcctgg
gacaatccgtccgagctgaaccgttcgctggagaccgccaagcgatccgtactcgagaaa
accaccgagttcttcaagagcggcgacgcgccggcggccaagaacgagaaacagttcggc
gtggtgggcgcccatttctccggcgtggccgcgctggtcaagggagacaactcgccgatc
aacggttacctggatcagttggccaagctgaaggtgaagatggtggccatcaccagcacc
gacgaaccgggcgcgcaggcgcgcaccgtgctgcagtcgacgctgaacggctcgggctcc
gagctgggcgacacgctgtcctacgtcgacaacaccttgctcaacggcgcgacgccggac
acggtggaaatggtgcgcccgatgctggtgcgcccgttgtcccagtcgtacagcgcgttg
ctgggcccggtggcgcaggatatcaaccaggcttgggccaatgaggtgctgccgcagtgg
cgccagctggccggaaagtatccgttcagcgattccagcagcagcgcgtcggtggccgac
atcaaccgcttcgtcaaggccaacgagggcacgctggacaaattcatcaacaaatacctg
actggcctggtgcagaagaagggcgacacgctggtgccgcgcgcatggggcaatgagggg
gtgcgtttcaacccgcaattcctcagcggcgtcagcagtctgatggcgctggccaacacc
cagttgcaagacggcgaaaatagccgcttcgaactgcagccgctgccgacgcccggcctg
tccgagatcgtgctgagcatagacggccaggaactgcgctaccgcaacggaccgcaacaa
tggcaaccgttcaattggccgggcagcggcagcgaaggcgcgcgcatccaggtggtgaat
tacgccggcgccagcaccgtggtgggcaaccagtccggccgcatgggcctgatgcgcctg
ttggccggcgccaaggtcaatgtcgatggcgacagcgcggcccagctgacctggacgctg
cccaagggcagcggcgcggaggggcaaactgtccgcttcaacttccgcatgctgggcggc
gtgaatccgctgcagttgaaccgcctgtacaaactgacgttgcccgagcgcgtgacgttg
taa

DBGET integrated database retrieval system