KEGG   Chlamydia psittaci 01DC11: CPS0A_0380Help
Entry
CPS0A_0380        CDS       T01860                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
chs  Chlamydia psittaci 01DC11
Brite
Enzymes [BR:chs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CPS0A_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C Imm3
Motif
Other DBs
NCBI-ProteinID: AEG86372
UniProt: A0A0E2IZB2
LinkDB All DBs
Position
396629..397246
Genome map
AA seq 205 aa AA seqDB search
MTFVPYTLPPLPYDYSALEPVISAEIMHLHHQKHHQGYINNLNEALKKLDLADTQQDLTR
LIALEPTLRFNGGGHINHSLFWEMLAPIGQGGGVPPKHGLLKLIEKFWGTFDNFLKEFIK
FAAPIQGSGWAWLAFCPEKQELMLHATANQDPLEATTGKVPLLGVDVWEHAYYLQYKNVR
LDYLKAIPQVINWGYIEKRFSEITN
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacctttgttccctatactttgcccccattgccctatgattattctgctctagagcca
gtaattagtgctgagattatgcatctacatcatcaaaagcatcatcaaggttatataaat
aatttgaatgaggccttgaagaagttagatctggctgatacacaacaagaccttacgcga
ttgattgctttggagcctactctacgatttaatggtgggggacatattaaccactcccta
ttttgggaaatgctcgccccgataggtcaaggcggaggggtccctccaaagcacggctta
ctgaagctgattgagaaattctggggaacttttgacaactttttaaaagaatttattaaa
tttgccgctccgattcaggggtctgggtgggcttggctagctttttgtcccgaaaaacag
gagcttatgctacacgcaacagcaaaccaggatcctctagaagccaccaccggtaaggtg
cctcttctcggagtagatgtctgggagcatgcgtattacctccagtataaaaatgttaga
ttagattatttaaaagcaattcctcaagtaattaattggggatatattgaaaaaagattt
tctgagataactaattaa

DBGET integrated database retrieval system