KEGG   Capra hircus (goat): 100860807
Entry
100860807         CDS       T02910                                 

Gene name
KITLG, MGF, SCF
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04072  Phospholipase D signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04640  Hematopoietic cell lineage
chx04916  Melanogenesis
chx05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100860807 (KITLG)
   04014 Ras signaling pathway
    100860807 (KITLG)
   04015 Rap1 signaling pathway
    100860807 (KITLG)
   04072 Phospholipase D signaling pathway
    100860807 (KITLG)
   04151 PI3K-Akt signaling pathway
    100860807 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100860807 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    100860807 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100860807 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    100860807 (KITLG)
Cytokines and growth factors [BR:chx04052]
 Growth factors
  Growth factors (RTK binding)
   100860807 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 100860807
NCBI-ProteinID: NP_001272599
UniProt: Q95M19
LinkDB
Position
5
AA seq 274 aa
MKKTQTWIITCIYLQLLLFNPLVHSQGICRNRVTDDVKDVTKLVANLPKDYMITLKYVPG
MDVLPSHCWISEMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSF
ENVKKSSKSPEPRQFTPEKFFGIFNKSIDAFKDLEIVASTMSECVISSTSSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASNSIEDSSLQWAAVALPAFFSLVIGFAFGALYWKK
KQPNLTRTVENRQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtccactctcaagggatctgccggaaccgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactatatgataaccctcaaatatgtccccggg
atggacgttttgcctagtcattgttggataagcgagatggtggaacaactgtcagtcagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagcaattattctatc
atagacaaacttgtgaaaatagttgatgaccttgtggagtgcatggaagaacactcattt
gagaatgtaaaaaaatcatctaagagcccagaacccaggcagtttactcctgagaaattc
tttggaatttttaataaatccatcgatgccttcaaggacttggagatagtggcttctaca
atgagtgaatgtgtgatttcctcaacatcaagtcctgagaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggcctcaaattccattgaagattccagcctacaatgggcagccgtagca
ttgccagcattcttttctcttgtgatcgggtttgcttttggggcgttatactggaagaag
aaacaaccaaatcttacaaggacagttgaaaacagacagattaatgaagaggataatgaa
ataagtatgttgcaagagaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system