KEGG   Capra hircus (goat): 100861303
Entry
100861303         CDS       T02910                                 

Gene name
CSF1R
Definition
(RefSeq) colony stimulating factor 1 receptor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04060  Cytokine-cytokine receptor interaction
chx04061  Viral protein interaction with cytokine and cytokine receptor
chx04151  PI3K-Akt signaling pathway
chx04380  Osteoclast differentiation
chx04640  Hematopoietic cell lineage
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100861303 (CSF1R)
   04014 Ras signaling pathway
    100861303 (CSF1R)
   04015 Rap1 signaling pathway
    100861303 (CSF1R)
   04151 PI3K-Akt signaling pathway
    100861303 (CSF1R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100861303 (CSF1R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100861303 (CSF1R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100861303 (CSF1R)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100861303 (CSF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100861303 (CSF1R)
   05202 Transcriptional misregulation in cancer
    100861303 (CSF1R)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100861303 (CSF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    100861303 (CSF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:chx04090]
    100861303 (CSF1R)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100861303 (CSF1R)
Protein kinases [BR:chx01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100861303 (CSF1R)
CD molecules [BR:chx04090]
 Proteins
  100861303 (CSF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 PKD_3 Ig_6
Other DBs
NCBI-GeneID: 100861303
NCBI-ProteinID: XP_017905657
LinkDB
Position
7
AA seq 964 aa
MGPRTLLILLVATAWHGQGVPVIEPSGPELVVEPGTAVTLRCMSNGSVKWDGPISPYWTL
DSEAPRSILSTNNATFLHTGTYRCTEPGDPLAGTAAIHLYVKDPVRPWRVLAEEVTVLEG
QDVLLPCLLTDPALEVGVSLARVRGRPVLRQTSYSFSPWYGFTIHKAKFIESQDYECSVR
VAGRVVKSLSIRLKVQKVIPGPPTLTLEPAELVRIQGETAKIVCSASDVDVNFDVFLQRG
DTKLAISQQSDFRDNRYQKVLTLKVDHVGFQDAGNYTCVATNARGVHTTSMVFRVVDSAY
LNLTSEQNLLQEVAVGEKLELRVKVEAYPSLQSFNWTYEGPFFGSQPKLNFVTTSDTYRY
TSKLTLPRLKPSEAGLYSFQARNARGEDTLTFELTLLYPPEVEVMWTLINGSKALLCEAS
GYPQPNVTWVQCSSHTNRCDKTHVLVLEELNPDVLRQEPFHKVTVQSLLTPGTLEHNRTY
ECRAQNSMGNTSGALGPISVGASMQPLDEPLFTPVLVACVSIMALLLLLLLLLFYKYKQK
PKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFG
LGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHLGPVLVIT
EYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEAGTGYKNIHLEKKYIRRDSGFSSQGVDTY
VEMRPVSTSSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAAR
NVLLTSGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTIQSDVWSYG
ILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPENIYSIMQACWALEPTRRPT
FQQICSLLQEQVQVGRRERDYSNLPSSGSSSSEPEEESSSEHLTCCEQGDIAQPLLQPNN
YQFC
NT seq 2895 nt   +upstreamnt  +downstreamnt
atgggcccacggaccctgctgatcctgctggtggccacagcttggcatggtcagggggtc
ccggtgatagagcccagtggccctgagctggtggtggagccaggcacagcggtgaccttg
cgatgtatgagcaatggcagcgtgaagtgggatggccccatttccccctactggactctg
gactctgaggcccccagaagcatcctcagcacgaacaatgccaccttcctgcacacggga
acgtaccgctgcactgagcctggagaccccttggcaggcactgctgctatccacctctac
gtcaaagaccctgttcggccctggagggtcctggccgaggaagtgacggtgctggagggt
caggacgtgctgctcccctgtctgctcaccgacccggcactggaggtgggcgtctcgctg
gcgcgggtgcgcggccggcctgtcttgcgccaaaccagctactccttctcgccgtggtac
ggcttcaccatccacaaggccaagtttattgagagccaggactacgagtgcagcgttcgg
gtggctggcagggtggtgaagtccctcagcatccggcttaaagttcagaaagtcatccca
ggaccgccgaccttgacactggagcctgcagaactggtgcggattcaaggagagactgct
aagattgtgtgctcagccagcgacgttgatgtcaactttgatgtcttccttcaacgtgga
gacacaaaacttgcaatctctcaacaatccgacttccgtgacaaccgttatcaaaaagtc
ctgaccctcaaagtcgatcacgtaggcttccaagatgccggcaactacacttgcgtggcc
accaatgcccggggcgtccacactacctccatggtcttccgggtggtagacagtgcctac
ttgaacttaacctccgagcagaatctcctccaagaggtagccgtgggtgagaagctcgaa
ctcagagtcaaggtggaggcctacccaagcctgcaaagtttcaactggacctatgagggt
cccttctttggctcccagccaaagctcaactttgtaaccaccagcgacacatacagatat
acctccaagctcaccctgcctcgcctgaagccctccgaggccggcctctactcgttccag
gctagaaacgccagaggcgaagataccctgacctttgaactcacccttctataccccccg
gaggtagaagtcatgtggaccctcatcaatggctccaaagccctgctctgtgaagcctca
gggtacccccagcccaatgtgacgtgggtgcagtgcagcagccacaccaacagatgtgat
aagacccacgtgctggtcctggaggagctgaaccctgacgtcctgcgccaggagcccttc
cacaaggtgaccgtccagagcctgctgacccctgggaccttggaacacaacaggacgtac
gagtgcagggcccagaacagcatggggaacacctccggcgccttggggcccatctctgta
ggagcctccatgcagcccctcgatgagcccctcttcacaccggtgctggtggcctgcgtg
tccatcatggccttgctgctgctgctgctgctgctgctcttctacaagtacaagcagaag
cccaagtaccaggtgcgctggaagatcatcgagagctatgaaggcaacagctacaccttc
atcgaccccacccagctgccctacaatgagaagtgggagttcccccggaacaacctgcag
tttggtaagaccctcggagccggagcctttgggaaggtggtagaggccacggcttttggt
ctgggcaaggaagatgctgtcctgaaggtggctgtgaagatgctgaagtccacggcgcat
gctgacgagaaggaagccctcatgtcagagctgaagatcatgagccacctgggccagcac
gagaacatagtcaacctcctgggagcctgtacccatctaggccctgtccttgtcatcacg
gagtattgttgctatggtgacctgctcaactttctgcgaaggaaggctgaggccatgctg
ggacccagcctgagtccaggccaggatcccgaggcaggcaccggctacaagaacatccac
ttggaaaagaaatacatccgcagggacagtggcttctccagccagggtgtggacacctac
gtggagatgagacctgtgtccacttcttcgtcaaatgactcattctctgaacaagacctg
gacaaggaggacgggcggccactggagctgcgtgacctgctccacttctcgagccaggtg
gcccaaggcatggcctttcttgcttccaagaattgcatccatcgggacgtggcggccaga
aacgtgctgctgaccagcggccacgtggccaagattggggacttcggtctggctcgggac
atcatgaatgactccaactacatcgttaagggcaatgctcgcctgcccgtgaagtggatg
gcgccagagagcatctttgactgcgtctacaccattcagagtgacgtgtggtcctacggc
atcctgctctgggagatcttctcactcgggctcaacccctaccctggcatcctggtgaac
agcaagttctataagctggtgaaggatggataccaaatggctcagcccgcgtttgcccca
gagaacatatacagcatcatgcaggcctgctgggccctggagccaacgcgcagacccacc
ttccagcagatctgctccctcctccaggagcaggttcaggtgggcaggagagagcgggac
tacagcaatctgccgagcagcggcagcagcagcagtgagccggaggaggagagctccagc
gagcacctgacctgctgtgagcagggcgacatcgcccagcccctgctgcaacccaacaac
taccagttctgctga

DBGET integrated database retrieval system