KEGG   Capra hircus (goat): 100861308
Entry
100861308         CDS       T02910                                 

Gene name
RHEB
Definition
(RefSeq) Ras homolog enriched in brain
  KO
K07208  Ras homolog enriched in brain
Organism
chx  Capra hircus (goat)
Pathway
chx04072  Phospholipase D signaling pathway
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04211  Longevity regulating pathway
chx04218  Cellular senescence
chx04714  Thermogenesis
chx04910  Insulin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05168  Herpes simplex virus 1 infection
chx05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100861308 (RHEB)
   04151 PI3K-Akt signaling pathway
    100861308 (RHEB)
   04152 AMPK signaling pathway
    100861308 (RHEB)
   04150 mTOR signaling pathway
    100861308 (RHEB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100861308 (RHEB)
  09143 Cell growth and death
   04218 Cellular senescence
    100861308 (RHEB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100861308 (RHEB)
   04919 Thyroid hormone signaling pathway
    100861308 (RHEB)
  09149 Aging
   04211 Longevity regulating pathway
    100861308 (RHEB)
  09159 Environmental adaptation
   04714 Thermogenesis
    100861308 (RHEB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100861308 (RHEB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100861308 (RHEB)
   05163 Human cytomegalovirus infection
    100861308 (RHEB)
   05165 Human papillomavirus infection
    100861308 (RHEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:chx04031]
    100861308 (RHEB)
GTP-binding proteins [BR:chx04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    100861308 (RHEB)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU SRPRB RsgA_GTPase AAA_14
Other DBs
NCBI-GeneID: 100861308
NCBI-ProteinID: NP_001272585
UniProt: E3UTA1
LinkDB
Position
4
AA seq 184 aa
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQLVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQVPIMLVGNK
KDLHMERVISYEGGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS
CSVM
NT seq 555 nt   +upstreamnt  +downstreamnt
atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc
tcgttgacgattcagtttgttgaaggccaacttgttgactcctacgatccaaccatagaa
aatactttcacaaaattgatcacagtaaatggacaggagtatcatcttcagcttgtggac
acagctgggcaggatgaatattccatctttcctcagacatactccatagatattaatggt
tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgatcaaagttatccat
ggcaaattattggatatggtggggaaagtacaagtacctattatgttggttgggaataag
aaagacctacatatggaaagggtgatcagttatgaaggagggaaagcgttagcagagtct
tggaacgcagcgtttttggaatcatctgcaaaagaaaatcagactgctgttgatgttttt
agaaggataattttggaggcagaaaaaatcgatggggccgcttcacaaggaaagtcttcc
tgctcggtgatgtga

DBGET integrated database retrieval system