Capra hircus (goat): 100861308 Help Entry 100861308         CDS       T02910                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism chx  Capra hircus (goat) Pathway chx04072   Phospholipase D signaling pathway chx04140   Autophagy - animal chx04150   mTOR signaling pathway chx04151   PI3K-Akt signaling pathway chx04152   AMPK signaling pathway chx04211   Longevity regulating pathway chx04218   Cellular senescence chx04714   Thermogenesis chx04910   Insulin signaling pathway chx04919   Thyroid hormone signaling pathway chx05163   Human cytomegalovirus infection chx05165   Human papillomavirus infection chx05168   Herpes simplex virus 1 infection chx05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     100861308 (RHEB)    04151 PI3K-Akt signaling pathway     100861308 (RHEB)    04152 AMPK signaling pathway     100861308 (RHEB)    04150 mTOR signaling pathway     100861308 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100861308 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     100861308 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     100861308 (RHEB)    04919 Thyroid hormone signaling pathway     100861308 (RHEB)   09149 Aging    04211 Longevity regulating pathway     100861308 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     100861308 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     100861308 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     100861308 (RHEB)    05163 Human cytomegalovirus infection     100861308 (RHEB)    05165 Human papillomavirus infection     100861308 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:chx04031]     100861308 (RHEB) GTP-binding proteins [BR:chx04031]  Small (monomeric) G-proteins   Ras Family    Rheb     100861308 (RHEB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 DUF1842 Motif Other DBs NCBI-GeneID:  100861308 NCBI-ProteinID:  NP_001272585 UniProt:  E3UTA1 LinkDB All DBs Position 4:5808330..5859807 Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQLVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQVPIMLVGNK KDLHMERVISYEGGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcgttgacgattcagtttgttgaaggccaacttgttgactcctacgatccaaccatagaa aatactttcacaaaattgatcacagtaaatggacaggagtatcatcttcagcttgtggac acagctgggcaggatgaatattccatctttcctcagacatactccatagatattaatggt tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgatcaaagttatccat ggcaaattattggatatggtggggaaagtacaagtacctattatgttggttgggaataag aaagacctacatatggaaagggtgatcagttatgaaggagggaaagcgttagcagagtct tggaacgcagcgtttttggaatcatctgcaaaagaaaatcagactgctgttgatgttttt agaaggataattttggaggcagaaaaaatcgatggggccgcttcacaaggaaagtcttcc tgctcggtgatgtga

DBGET integrated database retrieval system