KEGG   Capra hircus (goat): 102169291
Entry
102169291         CDS       T02910                                 

Gene name
ATG5
Definition
(RefSeq) autophagy related 5
  KO
K08339  autophagy-related protein 5
Organism
chx  Capra hircus (goat)
Pathway
chx04136  Autophagy - other
chx04137  Mitophagy - animal
chx04140  Autophagy - animal
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04216  Ferroptosis
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102169291 (ATG5)
   04136 Autophagy - other
    102169291 (ATG5)
   04137 Mitophagy - animal
    102169291 (ATG5)
  09143 Cell growth and death
   04216 Ferroptosis
    102169291 (ATG5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102169291 (ATG5)
   04622 RIG-I-like receptor signaling pathway
    102169291 (ATG5)
  09149 Aging
   04211 Longevity regulating pathway
    102169291 (ATG5)
   04213 Longevity regulating pathway - multiple species
    102169291 (ATG5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102169291 (ATG5)
   03029 Mitochondrial biogenesis [BR:chx03029]
    102169291 (ATG5)
Membrane trafficking [BR:chx04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    102169291 (ATG5)
Mitochondrial biogenesis [BR:chx03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    102169291 (ATG5)
SSDB
Motif
Pfam: APG5 Benyvirus_14KDa
Other DBs
NCBI-GeneID: 102169291
NCBI-ProteinID: XP_005684667
UniProt: A0A452FAH8
LinkDB
Position
9
AA seq 275 aa
MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVM
RQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDV
IEAHFMSCVKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEEN
GFRYIPFRIYQTTTERPFIQKLFRPVSTDGQLHTLGDLLKEVCPSAVAPEDGEKKNQVMI
HGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
NT seq 828 nt   +upstreamnt  +downstreamnt
atgacagatgacaaagatgtgcttcgagatgtgtggtttggacgaattccaacttgcttc
accctgtatcaggatgagataactgaacgtgaggcagaaccatattatttgcttttgcca
agagtaagttatttgacgttggtaactgacaaagtgaaaaagcactttcagaaggttatg
agacaagaagacattagtgagatatggtttgaatatgaaggcacaccactgaaatggcat
tatccaattggtttgctatttgatcttcttgcatcaagttcagctcttccttggaacatc
acagtacattttaagagttttccagaaaaggaccttctacactgtccatctaaggatgta
attgaagctcattttatgtcttgtgtgaaagaagctgatgctttaaagcacaaaagtcaa
gtaatcaatgaaatgcagaaaaaagatcacaagcaactctggatgggtttacaaaatgac
agatttgaccagttttgggccatcaatcggaaactcatggaatatcctgcagaagaaaat
ggatttcgttatatcccttttagaatataccagacaacaactgaacggcctttcattcag
aagctttttcgacctgtgtctacagatggacagttgcataccctaggagatctcctcaaa
gaagtctgtccttctgcagttgctcctgaagatggggaaaaaaagaaccaagtaatgatt
catggaattgaaccaatgttggaaacacctttgcagtggctgagtgaacatctgagctac
ccggataattttcttcatattagcatcatcccgcaaccaacagattga

DBGET integrated database retrieval system