KEGG   Capra hircus (goat): 102172519
Entry
102172519         CDS       T02910                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04062  Chemokine signaling pathway
chx04068  FoxO signaling pathway
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04137  Mitophagy - animal
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04210  Apoptosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04218  Cellular senescence
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04625  C-type lectin receptor signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04714  Thermogenesis
chx04720  Long-term potentiation
chx04722  Neurotrophin signaling pathway
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04730  Long-term depression
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04912  GnRH signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04926  Relaxin signaling pathway
chx04929  GnRH secretion
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx04960  Aldosterone-regulated sodium reabsorption
chx05010  Alzheimer disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05034  Alcoholism
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05207  Chemical carcinogenesis - receptor activation
chx05208  Chemical carcinogenesis - reactive oxygen species
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05216  Thyroid cancer
chx05218  Melanoma
chx05219  Bladder cancer
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102172519 (KRAS)
   04012 ErbB signaling pathway
    102172519 (KRAS)
   04014 Ras signaling pathway
    102172519 (KRAS)
   04015 Rap1 signaling pathway
    102172519 (KRAS)
   04370 VEGF signaling pathway
    102172519 (KRAS)
   04371 Apelin signaling pathway
    102172519 (KRAS)
   04068 FoxO signaling pathway
    102172519 (KRAS)
   04072 Phospholipase D signaling pathway
    102172519 (KRAS)
   04071 Sphingolipid signaling pathway
    102172519 (KRAS)
   04151 PI3K-Akt signaling pathway
    102172519 (KRAS)
   04150 mTOR signaling pathway
    102172519 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102172519 (KRAS)
   04137 Mitophagy - animal
    102172519 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102172519 (KRAS)
   04218 Cellular senescence
    102172519 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102172519 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102172519 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102172519 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102172519 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    102172519 (KRAS)
   04660 T cell receptor signaling pathway
    102172519 (KRAS)
   04662 B cell receptor signaling pathway
    102172519 (KRAS)
   04664 Fc epsilon RI signaling pathway
    102172519 (KRAS)
   04062 Chemokine signaling pathway
    102172519 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102172519 (KRAS)
   04929 GnRH secretion
    102172519 (KRAS)
   04912 GnRH signaling pathway
    102172519 (KRAS)
   04915 Estrogen signaling pathway
    102172519 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    102172519 (KRAS)
   04917 Prolactin signaling pathway
    102172519 (KRAS)
   04921 Oxytocin signaling pathway
    102172519 (KRAS)
   04926 Relaxin signaling pathway
    102172519 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    102172519 (KRAS)
   04919 Thyroid hormone signaling pathway
    102172519 (KRAS)
   04916 Melanogenesis
    102172519 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102172519 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102172519 (KRAS)
   04726 Serotonergic synapse
    102172519 (KRAS)
   04720 Long-term potentiation
    102172519 (KRAS)
   04730 Long-term depression
    102172519 (KRAS)
   04722 Neurotrophin signaling pathway
    102172519 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102172519 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102172519 (KRAS)
   04213 Longevity regulating pathway - multiple species
    102172519 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102172519 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102172519 (KRAS)
   05206 MicroRNAs in cancer
    102172519 (KRAS)
   05205 Proteoglycans in cancer
    102172519 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    102172519 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    102172519 (KRAS)
   05203 Viral carcinogenesis
    102172519 (KRAS)
   05230 Central carbon metabolism in cancer
    102172519 (KRAS)
   05231 Choline metabolism in cancer
    102172519 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102172519 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102172519 (KRAS)
   05212 Pancreatic cancer
    102172519 (KRAS)
   05225 Hepatocellular carcinoma
    102172519 (KRAS)
   05226 Gastric cancer
    102172519 (KRAS)
   05214 Glioma
    102172519 (KRAS)
   05216 Thyroid cancer
    102172519 (KRAS)
   05221 Acute myeloid leukemia
    102172519 (KRAS)
   05220 Chronic myeloid leukemia
    102172519 (KRAS)
   05218 Melanoma
    102172519 (KRAS)
   05211 Renal cell carcinoma
    102172519 (KRAS)
   05219 Bladder cancer
    102172519 (KRAS)
   05215 Prostate cancer
    102172519 (KRAS)
   05213 Endometrial cancer
    102172519 (KRAS)
   05224 Breast cancer
    102172519 (KRAS)
   05223 Non-small cell lung cancer
    102172519 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102172519 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    102172519 (KRAS)
   05161 Hepatitis B
    102172519 (KRAS)
   05160 Hepatitis C
    102172519 (KRAS)
   05163 Human cytomegalovirus infection
    102172519 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102172519 (KRAS)
   05165 Human papillomavirus infection
    102172519 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102172519 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102172519 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    102172519 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102172519 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102172519 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102172519 (KRAS)
   01522 Endocrine resistance
    102172519 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102172519 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:chx04031]
    102172519 (KRAS)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102172519 (KRAS)
GTP-binding proteins [BR:chx04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102172519 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 102172519
NCBI-ProteinID: XP_017903877
EnsemblRapid: ENSCHIG00000026575
UniProt: A0A452G867
LinkDB
Position
5:83368043..83412230
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata
aaaagagttaaagactctgaagatgtacctatggttctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattgttatgtaa

DBGET integrated database retrieval system