KEGG   Capra hircus (goat): 102174883
Entry
102174883         CDS       T02910                                 

Gene name
MYD88
Definition
(RefSeq) myeloid differentiation primary response 88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04064  NF-kappa B signaling pathway
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx05132  Salmonella infection
chx05133  Pertussis
chx05134  Legionellosis
chx05135  Yersinia infection
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05143  African trypanosomiasis
chx05144  Malaria
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05161  Hepatitis B
chx05162  Measles
chx05164  Influenza A
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102174883 (MYD88)
   04064 NF-kappa B signaling pathway
    102174883 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102174883 (MYD88)
   04621 NOD-like receptor signaling pathway
    102174883 (MYD88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102174883 (MYD88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102174883 (MYD88)
   05135 Yersinia infection
    102174883 (MYD88)
   05133 Pertussis
    102174883 (MYD88)
   05134 Legionellosis
    102174883 (MYD88)
   05152 Tuberculosis
    102174883 (MYD88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102174883 (MYD88)
   05161 Hepatitis B
    102174883 (MYD88)
   05171 Coronavirus disease - COVID-19
    102174883 (MYD88)
   05164 Influenza A
    102174883 (MYD88)
   05162 Measles
    102174883 (MYD88)
   05168 Herpes simplex virus 1 infection
    102174883 (MYD88)
   05169 Epstein-Barr virus infection
    102174883 (MYD88)
  09174 Infectious disease: parasitic
   05144 Malaria
    102174883 (MYD88)
   05145 Toxoplasmosis
    102174883 (MYD88)
   05140 Leishmaniasis
    102174883 (MYD88)
   05142 Chagas disease
    102174883 (MYD88)
   05143 African trypanosomiasis
    102174883 (MYD88)
SSDB
Motif
Pfam: TIR Death TIR_2 CRT10
Other DBs
NCBI-GeneID: 102174883
NCBI-ProteinID: XP_013828846
LinkDB
Position
22
AA seq 383 aa
MGGAQNTSKGGLRVPTSPAPPPEISKAVMGRPPPPHIYWGSRLSGRAALLGRRPAGRDQV
GGVAEGEGGSAGQRRDSTARLLPGHPAMTEGVPSAGSALPTPAMFSLPLAALNVRVRRRL
SLFLNVRAPVAADWTVLAEAMDFEYLEIQQLEKYADPTSRLLDDWQRRPGASVGRLLELL
AKLGREDVLMELGPSIEEDCQKYILKQQQEASEKPLQVDSIDSSIPRINDMAGITIRDDP
LGQKPEYFDAFICYCPSDIEFVHEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIE
KRCRRMVVVVSDEYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKPMKKEFPSILRFITV
CDYTNPCTQNWFWTRLAKALSMP
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgggtggagctcagaacacctcaaaaggcgggctccgggtccccacatccccagccccc
ccccccgagatctcgaaggcagtgatgggacgccccccgcctccgcacatctactggggc
tccagattgtcgggcagggcggcgcttctcggaaggagaccggcggggcgggatcaggtg
ggcggggtggccgaaggggaaggaggaagcgcaggccaacgacgcgactcgactgcgcgg
ctgctcccggggcaccccgccatgactgaaggagtccccagcgcggggtccgcgctcccc
acgcctgccatgttctccctgccgctggcagcgctcaacgtgcgagtgcggcgccgcctg
tcgctcttcctaaacgtgcgggcgccggtggcggccgactggaccgtgctggcggaggcg
atggacttcgagtacttggagatccagcagctggagaagtacgccgaccccacgagcagg
ctgctggacgactggcagcgacgtccgggcgcctcagtgggccgcctgctcgagctgctc
gccaagctcggccgcgaggacgtgctgatggaactgggacccagcatcgaggaggactgc
cagaagtatattctgaagcagcagcaggaggcatctgagaagcctttacaggtggactct
atagacagcagcatccctcggataaatgacatggcaggcatcactattcgcgacgacccc
ctagggcaaaagcctgagtattttgatgccttcatctgctactgccccagcgatattgag
tttgtccacgagatgatccggcagctggaacagacaaactatcggctgaagttgtgtgtg
tctgaccgtgacgtcctgcctggcacctgtgtctggtccatcgccagtgaactcattgag
aagaggtgccgtcggatggtggtggttgtctctgacgaatacctgcaaagcaaggaatgt
gacttccagactaagtttgcactcagcctctctccaggtgcccatcagaagcgactgatc
cccatcaagtacaagccaatgaagaaagagttccccagcatcctgcgcttcatcactgtc
tgtgactacaccaacccctgcacccagaactggttctggactcgcctcgccaaggccctg
tccatgccctga

DBGET integrated database retrieval system