Capra hircus (goat): 102178438 Help Entry 102178438         CDS       T02910                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04061   Viral protein interaction with cytokine and cytokine receptor chx04062   Chemokine signaling pathway chx04064   NF-kappa B signaling pathway chx04072   Phospholipase D signaling pathway chx04218   Cellular senescence chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04657   IL-17 signaling pathway chx04932   Non-alcoholic fatty liver disease chx04933   AGE-RAGE signaling pathway in diabetic complications chx04936   Alcoholic liver disease chx05132   Salmonella infection chx05133   Pertussis chx05134   Legionellosis chx05135   Yersinia infection chx05142   Chagas disease chx05144   Malaria chx05146   Amoebiasis chx05161   Hepatitis B chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05167   Kaposi sarcoma-associated herpesvirus infection chx05171   Coronavirus disease - COVID-19 chx05200   Pathways in cancer chx05202   Transcriptional misregulation in cancer chx05219   Bladder cancer chx05323   Rheumatoid arthritis chx05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102178438 (CXCL8)    04072 Phospholipase D signaling pathway     102178438 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102178438 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     102178438 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102178438 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102178438 (CXCL8)    04621 NOD-like receptor signaling pathway     102178438 (CXCL8)    04622 RIG-I-like receptor signaling pathway     102178438 (CXCL8)    04657 IL-17 signaling pathway     102178438 (CXCL8)    04062 Chemokine signaling pathway     102178438 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102178438 (CXCL8)    05202 Transcriptional misregulation in cancer     102178438 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     102178438 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     102178438 (CXCL8)    05171 Coronavirus disease - COVID-19     102178438 (CXCL8)    05164 Influenza A     102178438 (CXCL8)    05163 Human cytomegalovirus infection     102178438 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     102178438 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     102178438 (CXCL8)    05135 Yersinia infection     102178438 (CXCL8)    05133 Pertussis     102178438 (CXCL8)    05134 Legionellosis     102178438 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     102178438 (CXCL8)    05144 Malaria     102178438 (CXCL8)    05142 Chagas disease     102178438 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     102178438 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102178438 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102178438 (CXCL8)    04932 Non-alcoholic fatty liver disease     102178438 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     102178438 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     102178438 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:chx00536]     102178438 (CXCL8) Cytokines and neuropeptides [BR:chx04052]  Cytokines   Chemokines    102178438 (CXCL8) Glycosaminoglycan binding proteins [BR:chx00536]  Heparan sulfate / Heparin   Chemokines    102178438 (CXCL8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102178438 NCBI-ProteinID:  XP_005681806 UniProt:  A0A452FCP2 LinkDB All DBs Position 6:89335401..89338881 Genome browser AA seq 101 aa AA seqDB search MTSKLAVALLAAFLLSAALCEAAVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPH CENSEIIVKLTNGKEVCLDPKEKWVQKVVQAFLKRAEKQDP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggctgttgctctcttggccgctttcctgctctctgcagctctgtgt gaagctgcagttctgtcaagaatgagtacagaacttcgatgccaatgcataaaaacacat tccacacctttccaccccaaatttatcaaagaattgagagttattgagagtgggccacac tgcgaaaattcagaaatcattgttaagcttaccaacggaaaagaggtgtgcttagacccc aaggaaaagtgggtgcagaaggttgtgcaggcatttttgaagagagctgagaagcaagat ccatga

DBGET integrated database retrieval system