KEGG   Capra hircus (goat): 102178438
Entry
102178438         CDS       T02910                                 

Gene name
CXCL8, IL8
Definition
(RefSeq) C-X-C motif chemokine ligand 8
  KO
K10030  interleukin 8
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04061  Viral protein interaction with cytokine and cytokine receptor
chx04062  Chemokine signaling pathway
chx04064  NF-kappa B signaling pathway
chx04072  Phospholipase D signaling pathway
chx04218  Cellular senescence
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx05132  Salmonella infection
chx05133  Pertussis
chx05134  Legionellosis
chx05135  Yersinia infection
chx05142  Chagas disease
chx05144  Malaria
chx05146  Amoebiasis
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05219  Bladder cancer
chx05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102178438 (CXCL8)
   04072 Phospholipase D signaling pathway
    102178438 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102178438 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102178438 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102178438 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102178438 (CXCL8)
   04621 NOD-like receptor signaling pathway
    102178438 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    102178438 (CXCL8)
   04657 IL-17 signaling pathway
    102178438 (CXCL8)
   04062 Chemokine signaling pathway
    102178438 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102178438 (CXCL8)
   05202 Transcriptional misregulation in cancer
    102178438 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    102178438 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102178438 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102178438 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102178438 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102178438 (CXCL8)
   05135 Yersinia infection
    102178438 (CXCL8)
   05133 Pertussis
    102178438 (CXCL8)
   05134 Legionellosis
    102178438 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102178438 (CXCL8)
   05171 Coronavirus disease - COVID-19
    102178438 (CXCL8)
   05164 Influenza A
    102178438 (CXCL8)
   05163 Human cytomegalovirus infection
    102178438 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102178438 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102178438 (CXCL8)
   05144 Malaria
    102178438 (CXCL8)
   05142 Chagas disease
    102178438 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102178438 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:chx00536]
    102178438 (CXCL8)
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Chemokines
   102178438 (CXCL8)
Glycosaminoglycan binding proteins [BR:chx00536]
 Heparan sulfate / Heparin
  Chemokines
   102178438 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 102178438
NCBI-ProteinID: XP_005681806
UniProt: A0A452FCP2
LinkDB
Position
6
AA seq 101 aa
MTSKLAVALLAAFLLSAALCEAAVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPH
CENSEIIVKLTNGKEVCLDPKEKWVQKVVQAFLKRAEKQDP
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggctgttgctctcttggccgctttcctgctctctgcagctctgtgt
gaagctgcagttctgtcaagaatgagtacagaacttcgatgccaatgcataaaaacacat
tccacacctttccaccccaaatttatcaaagaattgagagttattgagagtgggccacac
tgcgaaaattcagaaatcattgttaagcttaccaacggaaaagaggtgtgcttagacccc
aaggaaaagtgggtgcagaaggttgtgcaggcatttttgaagagagctgagaagcaagat
ccatga

DBGET integrated database retrieval system