KEGG   Capra hircus (goat): 102182581Help
Entry
102182581         CDS       T02910                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04014  Ras signaling pathway
chx04062  Chemokine signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04371  Apelin signaling pathway
chx04713  Circadian entrainment
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04727  GABAergic synapse
chx04728  Dopaminergic synapse
chx04810  Regulation of actin cytoskeleton
chx04926  Relaxin signaling pathway
chx05032  Morphine addiction
chx05034  Alcoholism
chx05163  Human cytomegalovirus infection
chx05167  Kaposi's sarcoma-associated herpesvirus infection
chx05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    102182581
   04010 MAPK signaling pathway
    102182581
   04371 Apelin signaling pathway
    102182581
   04151 PI3K-Akt signaling pathway
    102182581
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    102182581
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    102182581
  Endocrine system
   04926 Relaxin signaling pathway
    102182581
  Nervous system
   04724 Glutamatergic synapse
    102182581
   04727 GABAergic synapse
    102182581
   04725 Cholinergic synapse
    102182581
   04728 Dopaminergic synapse
    102182581
   04726 Serotonergic synapse
    102182581
   04723 Retrograde endocannabinoid signaling
    102182581
  Environmental adaptation
   04713 Circadian entrainment
    102182581
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102182581
  Substance dependence
   05032 Morphine addiction
    102182581
   05034 Alcoholism
    102182581
  Infectious diseases
   05163 Human cytomegalovirus infection
    102182581
   05167 Kaposi's sarcoma-associated herpesvirus infection
    102182581
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102182581
  Exosomal proteins of colorectal cancer cells
   102182581
GTP-binding proteins [BR:chx04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    102182581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 102182581
NCBI-ProteinID: XP_017906767
LinkDB All DBs
Position
7
AA seq 72 aa AA seqDB search
MSSKVTIGSDIRQARRAVEQLRMEAGIDRMKVSKAAADLLQFCTEQAKSDPFLVGIPATI
NPFKEKKPCAIL
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaaggtgaccattggcagtgacattaggcaagcccgccgggctgtggagcag
ctgcggatggaggcgggcattgaccgcatgaaggtatccaaggcagctgccgacctgctg
cagttctgcacagagcaggccaagagtgacccctttctcgtgggcatcccagccaccatc
aaccccttcaaggagaagaagccctgcgccatcctgtga

DBGET integrated database retrieval system