KEGG   Capra hircus (goat): 108636847
Entry
108636847         CDS       T02910                                 

Gene name
TICAM2
Definition
(RefSeq) toll like receptor adaptor molecule 2
  KO
K05409  TRIF-related adaptor molecule
Organism
chx  Capra hircus (goat)
Pathway
chx04064  NF-kappa B signaling pathway
chx04217  Necroptosis
chx04620  Toll-like receptor signaling pathway
chx05133  Pertussis
chx05161  Hepatitis B
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    108636847 (TICAM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108636847 (TICAM2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108636847 (TICAM2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108636847 (TICAM2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    108636847 (TICAM2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    108636847 (TICAM2)
SSDB
Motif
Pfam: TIR_2 TIR MRI
Other DBs
NCBI-GeneID: 108636847
NCBI-ProteinID: XP_017909212
UniProt: A0A452E841
LinkDB
Position
10
AA seq 232 aa
MGIGKSKTDPCHLSVPWGKSQSVDTSQSPQTSDSKQSEDISLHGDAVCSTTAEMPAGEQE
GVEESPEEDTEEEVFLKFVILHAEEDTAEALRVQSLLENDFGIKPGIIFAEMPCGRQHLQ
NLDDAVNGSAWTILLLTENFLRDTWCKFQFYSSLMNSVNRQHKYNSVIPMRPLNKPLPRE
RTPFALRTINALEEESRGFPTQVERIFQESVYRIQQAIWKETRNMVQRQSVA
NT seq 699 nt   +upstreamnt  +downstreamnt
atgggtatcggaaagtctaaaacggatccctgccatctttctgtgccctggggtaaaagc
cagagtgtggatactagtcaaagccctcagacgtcagattccaagcaatctgaagacatc
tccctgcatggtgatgctgtgtgcagcactactgcagagatgccagcaggggagcaggag
ggagtggaggagagccctgaagaggacacagaagaagaggtgttcctcaaatttgtgata
ctgcacgctgaagaagacacagccgaagccctccgagtccagagcctgctggaaaacgac
tttggcatcaagcctggaatcatctttgccgagatgccatgtggcagacagcatttacag
aacttggatgatgctgtcaacgggtctgcctggactatcttactgttgactgaaaacttc
ttaagggacacctggtgtaagttccagttctattcgtccctcatgaactccgttaacagg
cagcacaagtacaactccgtcatccctatgcggcccctgaacaagcccctgccccgagag
agaactccctttgctctacggaccatcaacgccctggaggaagaaagtcgtggctttcct
acccaggtggaaaggatttttcaggagtctgtgtacaggatacagcaagctatatggaag
gagaccagaaatatggtacaaaggcaatctgttgcctga

DBGET integrated database retrieval system