KEGG   Citrobacter sp. CRE-46: AN232_14045Help
Entry
AN232_14045       CDS       T05520                                 

Definition
(GenBank) decarboxylating cobalt-precorrin-6B (C(15))-methyltransferase
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
cie  Citrobacter sp. CRE-46
Pathway
cie00860  Porphyrin and chlorophyll metabolism
cie01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cie00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AN232_14045
Enzymes [BR:cie01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     AN232_14045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_31 Cons_hypoth95 Methyltransf_12 PrmA Methyltransf_25 PCMT GidB Met_10 CMAS Methyltransf_11 Methyltransf_4 Methyltransf_2 Methyltransf_18 Methyltransf_23 DOT1 RrnaAD Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: AWS96248
UniProt: A0A2Z3X5T0
LinkDB All DBs
Position
2890284..2890853
Genome map
AA seq 189 aa AA seqDB search
MKDELFLRGEKVPMTKEAVRALALSKLELHRASHLIDIGAGTGSVSIEAALQYPGLRVTA
IERNPAALRLLDENRQHFACANIDIFPGVAPMTIAEKADAIFMGGSGGHLTDLIDWSMRQ
LHPAGRLVMTFILQENLNTALAHLDHLGVQGVDCLQLQVSSLTTLGSGHYFKPNNPVFVI
ACQKEGNHV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgagctgtttctgcgtggagagaaggtgccgatgaccaaagaagcggtacgc
gcacttgccctctcaaaacttgaattacaccgcgccagtcacctgattgatattggtgcg
ggaacaggcagtgtgtcgatagaagcggcgctgcaatatccaggattgcgtgtgacggca
atcgaacgtaacccggcggcgctcaggttgctggatgaaaatcgccagcattttgcctgc
gcaaatatcgacatttttcccggcgttgcgccaatgaccatcgccgaaaaagccgatgcc
atttttatgggcggcagcggtgggcatctgaccgatctcattgactggtcgatgcgtcag
ctgcatcccgccgggcggctggtcatgacgtttatccttcaggaaaacctcaataccgcg
ctggctcatctggaccatcttggcgtacagggagtggattgcctgcagctacaggtttcc
tcgcttaccacgcttggcagtggtcattatttcaaaccgaataaccccgtatttgttatc
gcctgtcagaaggaaggaaaccatgtctga

DBGET integrated database retrieval system