KEGG   Ciona intestinalis (sea squirt): 100181519Help
Entry
100181519         CDS       T01056                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin03030  DNA replication
cin03410  Base excision repair
cin03420  Nucleotide excision repair
cin03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cin00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100181519
   03410 Base excision repair
    100181519
   03420 Nucleotide excision repair
    100181519
   03430 Mismatch repair
    100181519
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cin03032]
    100181519
   03400 DNA repair and recombination proteins [BR:cin03400]
    100181519
Enzymes [BR:cin01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100181519
    6.5.1.6  DNA ligase (ATP or NAD+)
     100181519
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100181519
DNA replication proteins [BR:cin03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100181519
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100181519
DNA repair and recombination proteins [BR:cin03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100181519
   NER (nucleotide excision repair)
    Other NER factors
     100181519
   MMR (mismatch excision repair)
    Other MMR factors
     100181519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 100181519
NCBI-ProteinID: XP_009858016
UniProt: A0A1W3JMB1
LinkDB All DBs
Position
3
AA seq 1060 aa AA seqDB search
MLIGRSIKLLLTWHVKTYNCCVISPFQATSLWQHSKRLQNRNLFCLKQFGTDRLREILRI
PSATMPQKSIASFFGSKPSKKSPPATLQNKSSTKQENVKSPLKNSPSKKSPSKKSASESS
PVKLLPSENSPVSSPKKSVPNPKKIKNIESPVKIKKRKAQALISDSSEEEMDAVERSKTP
PPRKSPSSTRKVNLNQFKAKESGSDSDGVPNPPRDVKVTPNGTVKRKTARKSFQASKRLK
MNGNSSPEENEMKDEVKEEPGKDKEVEDESMEVEASDVQESGEREENNVTESINEGSNSD
SDHKVTPDTSSKKTKPKSPKHESSSDKEAKTEVSPNKTKSPASQKKTAVKKSPNTNSKSK
KSTKTSPKKEKQDSTPAAKPPKKFSSFFQSKDVAPEDNDEKKIKPDAYNPGRKNYHPVDH
ACWENGKKVPYLALARTFSLIEETSGRLRTIEILSNFLRSVIALSPNELITCIYLSLNKL
APAYEGIELGIGENLLMKAVAEATGRNIAKIKVDVGNTGDLGLVAENSRSNQKMMFTPAA
LTVDGVFKKLKQIAAISGGSSMSQKVSLVKSLLVACKHCEARYLMRSLGGKLRIGLAEQS
VLVAIANAAYLTPPGQDFPPAIINAGEKIPAETLKSKMDEKALIVKTTYSELPNYDIVIK
TMLEHGVDKLPDHCRLTPGIPLKPMLAHPTKGVSEVFNRFDKSEFTCEYKYDGERAQIHL
LEGGEVRIYSRNQENNTSKYPDIISRVPAMLKDEVTSCVIDSEAVAWDTDKKQILPFQVL
STRKRKDADLSTIKVQVCIYAFDLLYLNGESLVRKSFRERRKLLLDNFNVCDGQFVFAES
QDTTDTDKIAEFLEESIKGNCEGLMVKTLDDDATYEIAKRSHNWLKLKKDYLDGVGDTLD
LVVIGGYKGKGKRVGNYGGFLLACYDEESEEYQTICKIGTGFSDQNLADHAIFFNQHLID
QPKSYYRLNGSDADQWFEPVQVWEVKAADLSVSPVYAAANGIIDPERGISLRFPRFIRIR
DDKKPEEATNSQQVADLYHKQQQIQNQLKTKDSNKDVEYY
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atgttaattggtagatcaataaagttgttactgacgtggcatgtaaagacttacaactgt
tgtgtaatctcaccttttcaagccacaagtttgtggcaacattctaaaagattacagaac
aggaatcttttttgtttgaaacagtttgggacggataggttaagagagatactaagaata
ccaagcgctacaatgcctcaaaaatccattgcgtcatttttcggcagcaaaccgtcgaaa
aaatctccacctgcaactttacaaaacaaaagttccaccaagcaggaaaatgtgaagtct
cctttaaaaaattcgccttcgaaaaagtcaccttcaaaaaaatctgcttcggaaagttct
cctgtaaaacttcttccctcagaaaattctcctgttagttcaccgaaaaagtcagttccg
aatccgaaaaagataaaaaacatagagtcacctgtgaagataaaaaagaggaaagcacaa
gctttgatctcggattcatctgaagaagaaatggatgccgtcgaaagatcaaaaactcct
cctcccaggaagtcaccttcctcaacaaggaaagttaatcttaaccagtttaaggcaaaa
gaatctgggagcgattctgatggagttccgaatccaccacgtgatgttaaagttactcct
aatggaacggtgaaaagaaaaactgctcgtaaaagtttccaagcttcaaaacgtttgaag
atgaacgggaattcaagtccggaggaaaacgagatgaaagatgaagtgaaagaggagccg
ggtaaagataaagaggtggaagatgagagcatggaagtagaagcatctgatgtacaagaa
agtggtgaaagagaggaaaataatgtcactgagtcgataaatgaaggatcaaactctgac
tcggatcacaaagttacacctgacacttcttcaaagaagactaaaccgaaatctccaaaa
catgagagctcatctgataaagaggctaaaactgaagtatctccaaataaaactaaaagt
cctgcatcccaaaagaagacagcagtaaagaagtcacccaacacaaattccaagtcaaaa
aaatcgacaaaaacatcgccgaaaaaagaaaaacaagactcaacaccagccgcaaaacca
cccaagaaattttccagcttcttccagtccaaagatgttgctcctgaagataatgatgag
aagaagatcaaaccagatgcatataatcctggaaggaagaattatcatccagtggatcat
gcttgttgggaaaatggaaaaaaagtaccatatttggctctcgcaagaacttttagtctc
attgaagaaacctctggaagattaaggacgattgaaattctaagcaactttcttcgaagt
gtgatcgctctgtctcccaatgagctgataacttgtatatacctcagtctcaataaactt
gcaccagcttatgaaggaattgagcttggcataggagaaaacttgcttatgaaagcagtt
gccgaggcaacaggccgcaacatcgctaaaattaaagttgatgtcggcaacactggagat
ttgggacttgtagctgagaacagcagaagcaaccagaagatgatgttcacaccagctgct
ttaactgtagatggcgtgtttaaaaaactgaaacagattgcagcaatttctggaggctcg
tccatgagccagaaagtttcccttgttaaaagtttgctggttgcatgcaaacattgtgaa
gcaagatacttgatgaggtcccttggtggaaaactgaggattggtttggctgaacaatca
gtcttagttgcaattgctaatgcagcgtatttgacaccaccaggacaagattttccgccc
gctattataaacgctggtgaaaaaattcctgccgaaactttgaaatcaaaaatggatgaa
aaggctcttattgtgaagactacatacagtgaacttccaaactacgatattgttatcaaa
acaatgcttgaacatggggtggataagttgccagatcactgcagacttacaccaggtatt
ccacttaagccaatgttggcacatccaacaaaaggtgtttctgaagtttttaatcgtttc
gataaaagtgagttcacatgcgaatacaaatatgatggagagcgtgcacagatacatcta
cttgaagggggagaggttcggatatacagcagaaaccaggaaaataacacatccaagtac
ccagatattatctcaagagttccagcaatgctaaaggatgaagtgacatcgtgtgttatt
gattcagaagcagtggcatgggatacagataagaagcaaatcctacccttccaggtgtta
agtaccagaaaaaggaaagatgctgatttatcaacaattaaagtgcaagtttgcatttat
gcgtttgatctgctgtatcttaatggagagtcacttgttcggaagtcatttcgtgaaaga
agaaaattacttttggacaatttcaacgtttgtgatggacagtttgtgtttgctgagtca
caggacacaacagatactgacaaaattgcagagtttcttgaagaatcaattaaaggtaac
tgtgaagggttgatggtaaaaacattagatgacgatgccacgtatgagatcgcaaagcgt
tcacacaactggctgaaactaaaaaaggattatttggatggagtaggcgacacacttgac
ttggtagtgattggtggttataaaggcaaaggtaaaagggttggtaattatggagggttc
ttgcttgcttgttatgatgaggaaagtgaagaatatcaaactatttgtaagattggtact
ggattttcggaccagaacttggcagatcatgcaattttctttaaccaacatctgattgat
caaccaaaatcatattatagattaaatggtagtgatgctgatcaatggtttgaaccagtt
caggtttgggaagtgaaagccgctgatttatctgtgtctcctgtatatgctgctgctaat
ggaattattgatcctgagcgcggaatttcgctacgttttcctcgttttattcgaataaga
gatgacaagaaacctgaagaagcaaccaacagtcaacaggttgctgatctgtaccacaaa
cagcagcagattcaaaaccagttgaaaacaaaagattccaacaaagatgttgaatattat
tga

DBGET integrated database retrieval system