KEGG   Ciona intestinalis (sea squirt): 100184680
Entry
100184680         CDS       T01056                                 

Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
cin  Ciona intestinalis (sea squirt)
Brite
KEGG Orthology (KO) [BR:cin00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cin01001]
    100184680
Protein kinases [BR:cin01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100184680
SSDB
Motif
Pfam: CC2-LZ NEMO
Other DBs
NCBI-GeneID: 100184680
NCBI-ProteinID: XP_002128869
Ensembl: ENSCING00000008819
UniProt: F7BJ31
LinkDB
Position
7
AA seq 445 aa
MSTQSLSSYDPDQLTSGTYMGLPLPSTMLNSMLSQLLDNLITGNQDLKQTIKVNNEELYS
KCESLLKWKKDVDDKVKKLFDTCDRARVKVQSMKEQNALLLGENTRLKIQLEQPTNKPAE
NGEVDDVTEEQMVGNRMEETQRRYMQVVGSIENQLKEVMAERDTLKQSCLKLRNDNQTLQ
STIQSDRIQLEQLHQMHEDKQLLVNRINGLENDIELYKRRHADSEKTEKELKRQFHSLVE
ENKVFQKQGLDLKLQNDAARKEINDLGIIISHKNDQVQQVEKEKQNLQEAKDKIISKQKN
EVQEKCRAIDDLFVEYNNVREQKDRLTAEHALWKSQRSEYDNVYAQLICAEESLQKKDRE
IKELGEQVKKEGKETLMKMKKLEENVSFFKAQADVFRQDFLIEREDRGKLHDTNLQLQAS
LYEKERIVDQLKNQLEQYRYDAMRR
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgtctactcagagtttatcgtcatacgacccagaccaactaacaagtggaacgtacatg
gggttgcctctaccatccactatgttaaactcgatgcttagtcaactactggataacctt
ataactgggaaccaggacctaaaacaaactatcaaggtcaacaatgaagaattgtattcg
aaatgtgagtcattgttaaaatggaagaaagacgttgatgataaagtgaagaaactgttc
gatacctgtgacagagctcgagttaaagtgcaaagcatgaaggaacagaacgcattactg
cttggtgaaaacacacgactaaaaatacaattagaacaaccaactaataaaccagcagaa
aatggtgaggttgatgatgtcacagaggaacaaatggttggaaatagaatggaagaaacg
caaagaagatacatgcaagtagtcggcagtattgagaatcaattaaaggaggtaatggca
gaacgagacacactgaaacaaagttgtttaaaacttcgtaacgacaaccagacgttgcaa
agcacgatacaaagtgatcggatacaactcgagcaactacatcaaatgcatgaggataaa
cagttgctagtgaacagaattaatggtttagaaaatgacatcgaactgtataaacgaaga
catgcagattctgagaaaacagagaaagagttaaaacgacaattccattctctcgttgaa
gaaaataaagtctttcaaaaacaagggttggatttaaaacttcaaaatgatgctgcgaga
aaagaaataaatgacctaggaataataatcagtcataaaaacgatcaagtacaacaagtt
gaaaaggaaaaacaaaatcttcaggaagcaaaagacaaaatcatttctaagcaaaaaaat
gaagttcaagaaaaatgtcgtgcaattgatgatttgttcgtagagtacaataatgtgcgg
gaacagaaagatcgacttaccgcagaacacgctttgtggaaaagtcaacgttccgaatat
gataatgtttacgctcaacttatctgtgcagaggaatctttgcagaagaaagatcgagaa
atcaaagaactcggtgaacaggttaaaaaagaaggaaaagaaactttgatgaaaatgaaa
aagttggaagaaaatgtctcgtttttcaaagcacaggcggatgtatttcggcaagatttt
ctcattgaaagggaggatagggggaaactgcacgacacaaatctgcagctacaagcttcg
ttatacgagaaagaacgaattgtagatcagttgaagaatcagcttgaacagtacagatat
gatgcaatgagaagataa

DBGET integrated database retrieval system