KEGG   Citrobacter sp. CFNIH10: C2U53_07990Help
Entry
C2U53_07990       CDS       T05324                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cir  Citrobacter sp. CFNIH10
Pathway
cir00250  Alanine, aspartate and glutamate metabolism
cir00410  beta-Alanine metabolism
cir00640  Propanoate metabolism
cir00650  Butanoate metabolism
cir01100  Metabolic pathways
cir01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C2U53_07990
   00650 Butanoate metabolism
    C2U53_07990
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C2U53_07990
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C2U53_07990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cir01007]
    C2U53_07990
Enzymes [BR:cir01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C2U53_07990
Amino acid related enzymes [BR:cir01007]
 Aminotransferase (transaminase)
  Class III
   C2U53_07990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AUZ63777
LinkDB All DBs
Position
complement(942675..943940)
Genome map
AA seq 421 aa AA seqDB search
MKNNELNERRLQATPRGIGVMCGFYAERAENATLWDVEGREVIDFAAGIAVLNTGHRHPK
IIAAIEKQLQSFTHTAYQIVPYESYVRLAERINKRVPIDGPVKTAFFSTGAEAVENAVKI
ARAYTKRPGLITFGGAFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAQYPNALHGVSTV
DALQSLERIFKADIAPDQVAAIILEPVQGEGGFNIAPTAFMQALRALCDTHGILLIADEV
QTGFARTGKLFAMEHHGVQPDLMTMAKSLAGGMPLSAVAGRSEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIDEEQLCARAATLGTTLVEALNQAKADCPFIADIRAQGSMVAVEFND
PHSGKPSPEFTRQVQDRALQEGLLLLSCGVYGNVIRFLYPLTITDAQFRQALGIITHSLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaagaataacgaactgaatgaacggcgtttgcaggcgacgccgcgcgggatcggcgtg
atgtgtggcttttacgctgagagggcggaaaacgcaacattgtgggatgtggaaggccgt
gaggtgatcgattttgccgctggtattgcagtgctgaataccgggcatcgtcacccaaaa
atcatcgccgccatcgaaaaacagctccagtcttttactcataccgcttaccagattgtt
ccctacgaaagctatgtcagactggcggaacgtatcaataaacgtgtgccgattgacggg
ccggtgaagacggcattcttctccaccggggcagaagcggtggaaaacgcagtgaagatt
gcccgcgcatataccaaacgacccgggctcattacctttggcggcgctttccacgggcgg
actttcatgacgatggcgctgaccggtaaagtggcaccttacaaaatcggttttggcccg
ttccctggttcggtttatcacgctcagtaccctaatgcgttacacggtgtgagcaccgtc
gatgcgctgcaaagtctggagcgcatttttaaagctgatatcgcgccagatcaggttgcc
gccatcatccttgaaccggttcagggtgaaggaggctttaatattgcgccaacggcgttc
atgcaggcgctgcgggcgttgtgcgatacccacggtatcttgttgatcgccgatgaggtg
caaaccggctttgcccgtaccggcaaactgtttgcgatggagcatcatggcgtacagcct
gatctgatgacgatggcgaaaagcctggcaggcggtatgccgctctctgcggtcgctggc
cgttccgaagtgatggatgcccctgcgcctggtggtctggggggaacgtatgccggtaac
ccgctggcggttgctgcggcacacgcggtgctggatgtgattgatgaagaacagctctgc
gcccgcgccgctacattgggcacgacgctggtcgaggcgttgaaccaggcaaaagcggac
tgcccgtttattgccgatattcgcgcgcaggggtcgatggtggcggtagaattcaacgat
ccgcatagcggaaaaccttccccggaattcacgcggcaggtgcaggatcgcgccttgcag
gaaggacttctgctactgagttgcggcgtgtatggcaacgtcatccgttttctttatccg
ctcaccatcactgacgcgcaatttcgtcaggcgctcggcattatcacccactcgctgaca
cgataa

DBGET integrated database retrieval system