KEGG   Citrus sinensis (Valencia orange): 102620161Help
Entry
102620161         CDS       T02983                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
cit  Citrus sinensis (Valencia orange)
Brite
KEGG Orthology (KO) [BR:cit00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cit01001]
    102620161
Enzymes [BR:cit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102620161
Protein kinases [BR:cit01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   102620161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Pkinase_C RIO1 Kdo Haspin_kinase FTA2 APH
Motif
Other DBs
NCBI-GeneID: 102620161
NCBI-ProteinID: XP_006476697
LinkDB All DBs
Position
5
AA seq 441 aa AA seqDB search
MVSTSQKNLHSLLTTKLKKLTITPPSASSPDFDFTEVFGPLTPCRRNNQSPASTSASLGD
PQVIHNRSHSFVGPSPRYALSSSLRLQIQELEHENDAELEAESERKIGPGDFEILRVVGQ
GAFGKVFQVKKKGVDDGDSDGIYAMKVMRKDTIIKKNHVDYMKAERDILTKVTHPFIVQL
RYSFQTRSKLYLILDFINGGHLFFHLYRQGIFREDQARFYTAEIVSAVSHLHKCGIVHRD
LKPENILMDSDGHVMLTDFGLAKEIDESSRSNSMCGTTEYMAPEILLSKGHNKDADWWSV
GVLLYEMLTGQPPFTHANRQKLQQRIINEKVKLPPFLTSEAHSLLKGLLHKDPSKRLGSG
PGGVDTIKHHKWFRSINWKTLEAREMQPKFKPDVSGKDCIANFDKCWTTMPADDSPAPTP
TAGEHFKGYTYVAPNPWLSSV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccacgtcacagaaaaaccttcactcactattaacaacgaaactgaaaaagcta
accatcactccaccctccgcttcttccccagacttcgacttcaccgaagtcttcggaccc
ttaacgccctgccgccgcaacaaccaatcacctgcatccacgtcagcctctttgggtgac
ccgcaggtgatccacaaccgctcccactctttcgtgggtccctcccctcgttacgccctc
tcctcctcccttcgtctccaaatccaagaactcgaacacgaaaacgatgccgaattggaa
gctgaaagtgagagaaagatcgggccgggtgattttgagatattgagggttgtgggacag
ggcgcgtttggtaaagtgtttcaagtgaagaagaaaggagtcgatgatggcgatagtgat
gggatttatgcaatgaaagttatgagaaaagatacgattataaagaagaatcatgtggat
tacatgaaagctgaaagggatatcctcaccaaagtcacccatccttttattgtccagctc
cgctactctttccagacgaggtctaagctgtatttgatattggactttataaatggaggg
catctcttctttcatctgtatcggcaaggaatcttccgtgaggatcaggcaaggttttat
actgctgagatagtatctgcggtttcacatcttcacaagtgcgggatcgtgcaccgggat
cttaaaccagaaaatatactcatggattctgatgggcatgttatgctaactgatttcgga
cttgcaaaggaaattgacgaatcaagtagatcaaattcaatgtgtggaaccacagaatac
atggctcctgaaattttactttcaaaaggccacaacaaagatgcagactggtggagtgtt
ggagtactcctgtatgaaatgttgacggggcagccaccgtttacacatgcaaatagacag
aagcttcaacagagaattattaatgagaaagtgaaacttccaccttttcttaccagtgaa
gctcactctttgcttaaaggattgctgcacaaggacccatctaaaaggttaggtagcggg
cctggtggagtggacaccatcaaacaccacaaatggtttcgatcaatcaactggaagacg
ttggaggccagagaaatgcagccaaaattcaagccagatgtgagtggaaaagactgtata
gccaatttcgacaagtgctggacaacaatgccggcagatgattcaccggctcccacaccg
acagcaggtgagcatttcaaagggtacacttatgtggcgcctaacccttggctttcatca
gtgtga

DBGET integrated database retrieval system