KEGG   Citrus sinensis (Valencia orange): 102628869Help
Entry
102628869         CDS       T02983                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit03030  DNA replication
cit03410  Base excision repair
cit03420  Nucleotide excision repair
cit03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cit00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102628869
   03410 Base excision repair
    102628869
   03420 Nucleotide excision repair
    102628869
   03430 Mismatch repair
    102628869
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cit03032]
    102628869
   03400 DNA repair and recombination proteins [BR:cit03400]
    102628869
Enzymes [BR:cit01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102628869
    6.5.1.6  DNA ligase (ATP or NAD+)
     102628869
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102628869
DNA replication proteins [BR:cit03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102628869
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102628869
DNA repair and recombination proteins [BR:cit03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102628869
   NER (nucleotide excision repair)
    Other NER factors
     102628869
   MMR (mismatch excision repair)
    Other MMR factors
     102628869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 102628869
NCBI-ProteinID: XP_006488009
LinkDB All DBs
Position
8
AA seq 806 aa AA seqDB search
MLLTLRSCYPLRLTPLSGNVVKPTSFSRLSFSSHHLFQKPKPLSSSLNPRRKMSSSAPNA
FQVLMSAAAKKKPSPQPNSSSSSSSPKKRRTLDTQTPKTTNSVVGEKIQEVAEEPSNDLV
KPISNQIDNPIDSEKESQPTPPSPKKRKVNVNSVSAKEKIAELKSNIVLLKKKAGEFDPK
MVACWEKGERVPFIFLSLVFDMISNETGRILITDIVCNMLRTVMETTPEDLVPVVYLAAN
KIAPAHEGLELGIGDASIIKALAEACGRTESHVKKQYQEMGDLGLVAKASRSSQSMMRKP
DPLTITKVFDTFRLIAKEAGKDSQEKKKNRIKALLVAATDCEPQYLIRLLQSKLRIGLAE
QTLLAALGQAAVYNEQHSKPPPNIQSPLEEAAKIVKQVFSVLPVYEKIVPALLTDGVWNL
SNTCSFTPGIPIGPMLAKPTKGVSEIVNKFQDMEFTCEYKYDGERAQIHYLEDGSVEIYS
RNAERNTGKFPDVVLAVSRLKKPSVRSFVLDCEIVAYDREKQKILPFQTLSTRARKNVSL
SDIKVDVCIYAFDILYRNGQPLLQEQLRVRREHLYDSFEEEPGFFQFATTLTSIDLDEIQ
KFLDAAVDASCEGLIIKTMDRDATYEPSKRSLNWLKLKKDYIESIGDSLDLVPIAAFHGR
GKRTGVYGAFLLACYDSNNEEFQSICKIGTGFSEAMLEERSSSLRSKVIPKPRPYYRFAD
TISPDVWFEPTEVWEVKAADLTISPVHRAAIGVVDPDKGISLRFPRLIRVREDKTPEQAS
SSEQVAEMYTAQKLNHPNNQDDNEDD
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgttgctaactctccgttcatgttatcctcttcgcttaacacctctctccggcaacgtc
gtcaaaccaacatcattttctcgtctttctttctctagtcaccacttgtttcaaaaacct
aaacccctctcgtcttccctaaaccctagacgcaagatgtcctcctctgctcccaacgct
ttccaagttctcatgtccgccgctgcaaaaaagaaaccatcgcctcaacccaattcctca
tcttcttcttcttctcctaaaaagcgcagaaccctagacacccaaacccctaaaacgacg
aattcagtagtaggtgagaaaattcaagaagtcgctgaagaacccagtaacgatctcgta
aaacccatttcgaatcaaattgataatcccatagattctgagaaggaatcccaacccact
cctccatcacctaaaaaacgcaaagtcaatgtgaattcggtgagtgctaaggagaagatt
gcggaattgaagagcaatattgtgttattgaagaagaaagcgggtgaatttgatcccaaa
atggttgcatgttgggaaaagggagagagggtgccgtttatttttctgagtttggtgttt
gacatgatatcgaatgaaactgggcgaatattgattactgatattgtgtgtaatatgttg
aggacggttatggaaacgacgccggaggatttggtgccggttgtttatttggccgccaat
aagattgcaccagcccatgagggactggagctgggaattggggatgcttctattataaag
gcgcttgcggaggcctgtggaaggaccgaatctcacgttaagaagcaataccaggaaatg
ggagatctgggtcttgttgccaaggccagtcggtcctctcaatctatgatgcgcaagcct
gacccattaaccattaccaaagtttttgatacatttcggctcattgctaaggaagctggg
aaggatagccaagagaagaaaaagaatcgaatcaaggctcttcttgttgcagccactgac
tgtgaacctcaatatttgattcgtcttctccagtcaaagttgcgaattggattagcagag
cagactctcttagctgcattgggacaagctgctgtttataatgaacagcattctaaacct
cctccaaacattcaatcccctttagaggaggctgcaaagattgttaagcaagttttctcg
gtacttcctgtttatgaaaagattgtccctgcacttcttactgatggcgtatggaatctt
tcaaatacatgcagctttacgccaggcatcccaattggacctatgttagcaaaaccaacc
aaaggggtctctgagattgtaaacaagttccaagatatggaattcacatgtgaatacaaa
tatgatggagagcgagcccaaatacattatttggaggatggttctgttgagatatatagt
cgaaatgctgaacgcaacactggaaaatttcctgatgttgttcttgctgtttcaagatta
aagaagccttctgtaagatcatttgttctggactgtgaaattgttgcttacgatcgggaa
aaacagaaaatcttgcccttccagacccttagtactcgagctcgtaaaaatgtctctctc
agtgacatcaaggttgatgtctgcatatatgcttttgacattttgtatcgcaatggccaa
ccgcttcttcaggaacaactgagagttcgtagagagcatctttatgattcatttgaggaa
gagcctggattttttcagtttgcaacaactttaacatcaattgatcttgatgaaatacaa
aagtttctagatgctgctgttgatgcaagttgtgagggtctaattatcaaaacaatggat
cgagatgctacatatgagccttcaaagcgatcgcttaactggctaaaattaaagaaagat
tacattgagagtattggagactcgctggatttagtacccattgctgcatttcatggccgt
gggaaacgtacaggtgtttatggtgcctttctgttggcatgttatgacagcaataatgaa
gaatttcaaagcatatgtaaaataggcactggattttctgaagcgatgcttgaagaacgt
tcttccagtctccgttctaaagttatacccaaaccaaggccgtactaccggtttgctgat
actatcagtccagatgtatggttcgagccaacagaggtttgggaggtgaaagctgcggac
ttgactattagccctgttcatcgtgctgccattggtgttgtggatcctgataagggcatt
tctctccggtttcctcgcctaattcgtgttcgagaagacaagaccccagagcaggcttca
tcatctgagcaggtggcagagatgtatactgctcaaaaactcaatcatccaaacaatcaa
gatgacaatgaagatgattga

DBGET integrated database retrieval system