KEGG   Cellvibrio japonicus: CJA_0376Help
Entry
CJA_0376          CDS       T00721                                 

Gene name
ahpF
Definition
(GenBank) AhpF
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cja  Cellvibrio japonicus
Brite
KEGG Orthology (KO) [BR:cja00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CJA_0376 (ahpF)
Enzymes [BR:cja01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CJA_0376 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like AlaDh_PNT_C FAD_binding_3 DAO FMO-like Thi4 NAD_binding_8 K_oxygenase Glutaredoxin Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: ACE84838
UniProt: B3PI37
LinkDB All DBs
Position
475220..476770
Genome map
AA seq 516 aa AA seqDB search
MLDAAIKGQLKAYLEKLQRPIELVASLDDTAKSRELKSLLDEITALSDNVSARLDGNSVY
RPSFGVARPGETPRIEFAGIPLGHEFTSLVLALLHTGGHPARIDAATLEQIKAIDGQFHF
DIFVSLSCHNCPDVVQAVNTMAAQNPNISATMIDGALFQGEVEKRQIMAVPSVYLNGQHF
GQGRMTLEEILAKIDTGAAEREAKLLNGKVPFDVLVVGGGPAGSAAAIYAARKGIRTGVV
AERFGGQVLDTLAIENFISVTETEGPKLAMALEQHVKEYDVDVMNLQKAAELIPGDLIEV
KLASGASLKSKSVILTTGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGN
SGVEAAIDLAGIVAHVTLLEFDSTLRADAVLQRKLLSLPNVTVITEALTSEVLGDGQKVT
GLTYKNRNTDDLTQVELEGIFVQIGLLPNTDWLKGTVALSQRGEIEINTRGETSVPGVFA
AGDCTTVPYKQIIIAMGAGSTAALGAFDHLIRASAP
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgctgctattaaaggccagctcaaggcttacctcgaaaagctgcagcgcccg
attgaattggttgccagtctcgatgacactgccaaaagccgggaactcaaaagcctgctt
gacgagatcaccgctctgtcagacaacgtcagtgcgcgcctggatggcaactctgtgtat
cgtccttctttcggtgtggcccgtccgggagaaacaccgcgtattgagtttgccggtatt
cccctggggcatgaatttacctcactggtactcgcgctgttgcacacaggcggtcaccca
gcgcggattgatgctgcaacactggagcaaatcaaagccattgatggacagttccatttt
gatatttttgtgtcgctctcttgccataactgcccggatgttgtccaggctgttaatacc
atggcggcacaaaacccgaatatttctgccactatgattgatggcgcgctgttccaaggc
gaagtggaaaagcgccagatcatggcggtgcccagtgtctacctgaatggccagcacttt
ggccaggggcgcatgacgctggaggaaattcttgccaaaattgatacgggtgcagctgag
cgtgaagccaaattgcttaatggcaaagtacctttcgatgtattggttgtgggtggtggt
cccgctgggtcagcagcggctatttacgcggcgcgtaaaggcattcgcacgggcgttgtg
gccgagcgttttggtggtcaggtattggataccctggcgattgaaaactttatttcagta
acagaaaccgaaggccccaaacttgccatggcactggagcaacatgttaaggaatacgac
gtagatgtgatgaacctgcagaaagcggctgaacttatccccggtgacctgatcgaggtt
aagctggccagcggtgccagccttaaaagcaagagtgtgatccttaccaccggtgcgcgc
tggcgtgaaatgaatgtgccgggcgaaaaggaatatcgtggcaaaggtgttgcctattgt
ccccactgcgacggccctctgtttaaaggaaaacgcgttgcggtgattggcggcggtaat
tccggggtggaagcggcaattgacctggcaggtattgtcgcccatgtaacactgttggaa
ttcgattccacattgcgtgccgatgcggtgttgcagcgtaaattgttaagcttgccgaat
gtcactgttattacggaggccctgacaagcgaagtgcttggcgatggccagaaagtgaca
ggcttgacgtacaaaaaccgcaacacagatgaccttacccaggtggagttggaaggtatt
ttcgtccagattgggttactgccgaataccgattggctgaagggtacagtagcattgtcc
cagcgcggtgaaattgaaatcaatacacgtggtgaaacctctgtaccgggtgtattcgcc
gcgggtgattgcaccactgttccttacaagcaaattattattgcgatgggcgctggctcg
accgccgccttgggagcattcgatcatctgatcagagcaagtgcgccataa

DBGET integrated database retrieval system