KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100385309
Entry
100385309         CDS       T03264                                 

Gene name
WNT3A
Definition
(RefSeq) Wnt family member 3A
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100385309 (WNT3A)
   04390 Hippo signaling pathway
    100385309 (WNT3A)
   04150 mTOR signaling pathway
    100385309 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100385309 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100385309 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100385309 (WNT3A)
   05206 MicroRNAs in cancer
    100385309 (WNT3A)
   05205 Proteoglycans in cancer
    100385309 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100385309 (WNT3A)
   05226 Gastric cancer
    100385309 (WNT3A)
   05217 Basal cell carcinoma
    100385309 (WNT3A)
   05224 Breast cancer
    100385309 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100385309 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    100385309 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100385309 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100385309 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100385309 (WNT3A)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100385309 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100385309
NCBI-ProteinID: XP_008983910
Ensembl: ENSCJAG00000016650
UniProt: A0A5F4VZM6
LinkDB
Position
19
AA seq 352 aa
MAPLGYFLLLCSLKQVLGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKISIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGTAAICGCSSRHQGSPGKDWKWGGCSEDTEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAISSHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccccgctcggatacttcttacttctctgcagcctgaagcaggttctgggcagctac
ccgatctggtggtcactggcggtcgggccgcagtactcctccctgggctcgcagcccatc
ctgtgtgccagcatcccgggcctggtccccaagcagctgcgcttctgcaggaactacgtg
gagatcatgcccagcgtggccgagggcatcaagatcagcatccaggagtgccagcaccag
ttccgaggtcgccggtggaactgcaccaccgtccacgacagcctggccatctttggaccc
gtgctggacaaagcgacccgggagtcagcctttgtccacgccattgcctcagccggtgtg
gccttcgcggtgacacgctcatgtgcagagggcacggccgccatctgtggctgcagcagc
cgccaccagggctcaccaggcaaggactggaagtggggtggctgcagtgaggacaccgag
tttggtgggatggtgtctcgggaattcgccgatgcccgggagaaccggccagatgcccgc
tcagccatgaaccgccacaacaacgaggctgggcgccaggccatctccagccacatgcat
ctcaagtgcaagtgccacgggctgtcgggcagctgcgaggtgaagacatgctggtggtcg
cagcccgacttccgcgccatcggcgacttcctcaaggacaagtacgacagcgcctcggaa
atggtggtagagaagcaccgggagtcccgcggctgggtggagaccctgcggccgcgctac
acctacttcaaggtgcccacggagcgcgacctggtctactacgaagcgtcgcccaacttc
tgcgagcccaaccccgagacgggctccttcggcacgcgcgaccgcacctgcaacgtcagc
tcgcacggcatcgacggctgcgacctgctgtgctgcggccgcggtcacaacgcgcgcgcg
gagcggcgccgggagaagtgccgctgtgtgttccactggtgctgctacgtcagctgccag
gagtgcacgcgcgtctacgacgtgcacacctgcaagtag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387135
Entry
100387135         CDS       T03264                                 

Gene name
WNT4
Definition
(RefSeq) Wnt family member 4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04360  Axon guidance
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04919  Thyroid hormone signaling pathway
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100387135 (WNT4)
   04390 Hippo signaling pathway
    100387135 (WNT4)
   04150 mTOR signaling pathway
    100387135 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100387135 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100387135 (WNT4)
   04916 Melanogenesis
    100387135 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    100387135 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100387135 (WNT4)
   05205 Proteoglycans in cancer
    100387135 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100387135 (WNT4)
   05226 Gastric cancer
    100387135 (WNT4)
   05217 Basal cell carcinoma
    100387135 (WNT4)
   05224 Breast cancer
    100387135 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100387135 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    100387135 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100387135 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100387135 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100387135 (WNT4)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100387135 (WNT4)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100387135
NCBI-ProteinID: XP_008998844
Ensembl: ENSCJAG00000005892
LinkDB
Position
7
AA seq 296 aa
MCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLESLPVFGKVVTQGTREAAFVYAI
SSAGVAFAVTRACSSGELEKCGCDRTVHGVSPEGFQWSGCSDNIAYGVAFSQSFVDVRER
SKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALK
EKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRT
CNKTSKAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR
NT seq 891 nt   +upstreamnt  +downstreamnt
atgtgcaagcggaacctggaagtcatggactctgtgcgccgcggtgcccaactggccatt
gaggagtgccagtaccagttccggaaccggcgctggaactgctccacactcgaatccctg
cctgtcttcggcaaggtggtaacacaaggcactcgggaggcggccttcgtgtacgccatc
tcttcggcaggtgtggcctttgcggtgacgcgggcatgcagcagtggggagctggagaag
tgcggctgtgaccggacagtgcacggggtcagcccagagggcttccagtggtcaggatgc
tctgacaacatcgcctacggcgtggccttctcacagtcatttgtggatgtgcgggagaga
agcaagggggcctcatccagcagagccctcatgaacctccacaacaatgaggccggcagg
aaggccatcctgacacacatgcgggtggagtgcaagtgccacggggtgtcaggctcctgt
gaggtgaagacgtgctggcgagccgtgccgcccttccgccaggtgggtcacgcactgaag
gagaagtttgatggtgccactgaggtggagccgcgccgcgtgggctcctccagggcgctg
gtaccacgcaatgcacagttcaagccacacacagacgaggacctggtgtacttggagccc
agccccgacttctgcgagcaggacatgcgcagcggtgtgctgggcacgagaggccgcacg
tgcaacaagacatccaaggccatcgacggctgtgagctgctgtgctgcggccgcggcttc
cacacagcgcaggtggagctggctgaacgctgcagctgcaaattccactggtgctgcttt
gtcaagtgccggcagtgccagcggctcgtggagctgcacacatgccggtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387388
Entry
100387388         CDS       T03264                                 

Gene name
WNT16
Definition
(RefSeq) Wnt family member 16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100387388 (WNT16)
   04390 Hippo signaling pathway
    100387388 (WNT16)
   04150 mTOR signaling pathway
    100387388 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100387388 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100387388 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100387388 (WNT16)
   05202 Transcriptional misregulation in cancer
    100387388 (WNT16)
   05205 Proteoglycans in cancer
    100387388 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100387388 (WNT16)
   05226 Gastric cancer
    100387388 (WNT16)
   05217 Basal cell carcinoma
    100387388 (WNT16)
   05224 Breast cancer
    100387388 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100387388 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    100387388 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100387388 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100387388 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100387388 (WNT16)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100387388 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100387388
NCBI-ProteinID: XP_002752119
Ensembl: ENSCJAG00000017199
UniProt: A0A5F4WIZ2
LinkDB
Position
8
AA seq 365 aa
MGRAALQGLARLCALWAALLVLFPCGAQGNWMWLGIASFGIPEKLGCANLPLNNRQKELC
KRKPYLLPSIREGARLGIQECRSQFRHERWNCMITAASTTAPTGASPLFGYELSSGTKET
AFIYAVMAAGLVHSVTRSCSAVNMTECSCDATLQNGGSASEGWHWGGCSDDVQYGMWFSR
KFLDFPIKNTTGKENKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMS
SFEKIGHLLKDKYENSIQISDKIKRKMRRREKDQKKIPIHKDDLLYVNKSPNYCVEDKKL
GIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTD
VHTCK
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgggcagggcggcgctccagggactggcccgcctgtgcgcgctgtgggcagccctgctc
gtgctgttcccctgcggagcccaaggaaactggatgtggttgggcattgcctccttcggg
attccggagaagctgggctgtgccaacttgccgctgaacaaccgccagaaggagctgtgc
aagaggaaaccgtacctgctgccgagcatccgagagggcgcccggctgggcattcaggag
tgcaggagccagttcagacacgagagatggaactgcatgatcaccgcggcctccaccacc
gcccctacgggcgccagccccctctttggctacgagctgagcagcggcaccaaagagaca
gcatttatttatgccgtgatggctgcaggcctggtgcattctgtgaccaggtcatgcagt
gcagtcaacatgacagagtgttcctgtgatgccaccttgcagaacggcggctcagcaagt
gagggctggcactgggggggctgctccgatgatgtccagtacggcatgtggttcagcaga
aagttcctagatttccccatcaaaaacaccacgggcaaagaaaacaaagtactgttagcc
atgaacctacataacaatgaagctggaaggcaggctgtcgccaagctgatgtcagtagac
tgtcgctgccacggagtttccggctcttgtgctgtgaaaacatgctggaaaacgatgtct
tcttttgaaaagattggccatttgttgaaggataaatatgaaaacagtatccagatatca
gacaaaataaagaggaaaatgcgcaggagagaaaaagatcagaagaaaataccaatccac
aaggatgatctgctctatgttaataaatctcccaactactgtgtagaagataagaaactg
ggaatcccagggacacaaggcagagaatgtaaccgtacgtcagagggtgcagacggctgc
aacctcctctgctgtggccgaggctacaacacccatgtggtcaggcacgtggagaggtgt
gagtgtaagttcatctggtgctgctatgtccgttgcaggaggtgtgaaagcatgactgat
gtccacacgtgcaagtaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387909
Entry
100387909         CDS       T03264                                 

Gene name
WNT7A
Definition
(RefSeq) Wnt family member 7A
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100387909 (WNT7A)
   04390 Hippo signaling pathway
    100387909 (WNT7A)
   04150 mTOR signaling pathway
    100387909 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100387909 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100387909 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100387909 (WNT7A)
   05205 Proteoglycans in cancer
    100387909 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100387909 (WNT7A)
   05226 Gastric cancer
    100387909 (WNT7A)
   05217 Basal cell carcinoma
    100387909 (WNT7A)
   05224 Breast cancer
    100387909 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100387909 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    100387909 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100387909 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100387909 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100387909 (WNT7A)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100387909 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 100387909
NCBI-ProteinID: XP_002758695
Ensembl: ENSCJAG00000016899
UniProt: Q1KYK6 U3CFU1
LinkDB
Position
15
AA seq 349 aa
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggtggcttctcctcagtggtagctctgggcgcaagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcgatctgccagagccggcccgacgccatcatc
gtcataggagaaggctcacaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgctggaactgctctgcactgggggagcgcaccgtcttcgggaaggagctcaaagtgggg
agccgggaggccgcattcacctacgccatcattgctgctggtgtagcccacgccatcaca
gctgcctgtacccagggcaacctgagcgactgcggctgtgacaaggagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcccggactctcatg
aacttgcacaataacgaggcaggccgaaagatcctggaggagaacatgaagctggaatgt
aagtgccatggtgtatcaggctcgtgcaccaccaagacgtgctggaccacactgccacag
tttcgggagctgggctacgtgctcaaggacaagtacaacgaggccgttcacgtggagccc
gtgcgcgccagccgcaacaagcggcccaccttcctaaagatcaagaagccactgtcctac
cgcaagcccatggacaccgacctggtgtacatcgagaagtcgcccaactactgcgaggaa
gacccggtgaccggcagcgtgggcacccagggccgcgcctgcaacaagacggccccccaa
gccagcggctgtgacctcatgtgctgtgggcgtggctacaacacccaccagtacgcccga
gtgtggcagtgcaactgtaagttccactggtgctgctatgtcaagtgcaacacgtgcagc
gagcgcacggagatgtacacgtgcaagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388949
Entry
100388949         CDS       T03264                                 

Gene name
WNT10B
Definition
(RefSeq) Wnt family member 10B
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100388949 (WNT10B)
   04390 Hippo signaling pathway
    100388949 (WNT10B)
   04150 mTOR signaling pathway
    100388949 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100388949 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100388949 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100388949 (WNT10B)
   05205 Proteoglycans in cancer
    100388949 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100388949 (WNT10B)
   05226 Gastric cancer
    100388949 (WNT10B)
   05217 Basal cell carcinoma
    100388949 (WNT10B)
   05224 Breast cancer
    100388949 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100388949 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    100388949 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100388949 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100388949 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100388949 (WNT10B)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100388949 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100388949
NCBI-ProteinID: XP_002752467
Ensembl: ENSCJAG00000020802
UniProt: F7IIN7
LinkDB
Position
9
AA seq 389 aa
MLEEPRPRPPPSGFAGLLFLALCSRALSNEILGLKLPGEPPLTPNTVCLTLSGLSKRQLG
LCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGIMHAVATACSLGKLVSCGCGLKGSGEQDRLRAKLLQLQTLSRGKSFPHSLPSP
GPGSGPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgctggaggagccccggccgcggcctccgccctcgggcttcgcgggtctcctgttcctg
gcgttgtgcagtcgggctctcagcaatgagattctgggcctgaagttgcctggcgagccg
cctctgacacccaacaccgtgtgcctgacgctgtccggcctgagcaagcggcagctaggc
ctgtgcctgcgcaaccccgacgtgacggcgtccgcgcttcagggtctccacatcgcggtc
cacgagtgtcagcaccagctgcgtgaccagcgctggaactgctcagcgctcgagggcggc
ggccgtctgccgcaccacagcgccatcctcaagcgcggtttccgagaaagtgctttttcc
ttctccatgctggctgctggcatcatgcatgcagtagccacagcctgcagcctgggcaag
ctggtgagctgcggctgtggcttgaagggcagtggtgagcaggatcggctgagggccaaa
ctgctgcagctgcagacactgtctcgaggcaagagtttcccccactctctgcccagccct
ggccctggctcaggccccagtcctggcccccaggacacatgggaatggggtggctgtaac
catgacatggactttggagagaagttctctcgggatttcttggattccagggaagctccc
cgggacatccaggcacgaatgagaatccacaacaacagggtagggcgccaggtggtaact
gaaaacctgaagcggaaatgcaaatgccatggcacttcaggcagctgccagttcaagaca
tgctggagggcggccccagagttccgggcagtgggggcggcgttgagggaacggctgggc
cgggccatcttcatcgatacccacaaccgcaattctggagccttccaaccccgtctgcgt
ccccgtcgcctctcaggagagctggtctactttgagaagtctcctgacttctgtgagcga
gaccccactatgggctccccagggacaaggggccgggcctgcaataagaccagccgcctg
ttggatggctgtggcagcctgtgctgtggccgtgggcacaacgtgctcaggcagacacga
gttgagcgctgccattgccgcttccactggtgctgctatgtgctgtgtgatgagtgcaag
gtcacagagtgggtcaatgtgtgtaagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389319
Entry
100389319         CDS       T03264                                 

Gene name
WNT1
Definition
(RefSeq) Wnt family member 1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100389319 (WNT1)
   04390 Hippo signaling pathway
    100389319 (WNT1)
   04150 mTOR signaling pathway
    100389319 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100389319 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100389319 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100389319 (WNT1)
   05205 Proteoglycans in cancer
    100389319 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100389319 (WNT1)
   05226 Gastric cancer
    100389319 (WNT1)
   05217 Basal cell carcinoma
    100389319 (WNT1)
   05224 Breast cancer
    100389319 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100389319 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    100389319 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100389319 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100389319 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100389319 (WNT1)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100389319 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100389319
NCBI-ProteinID: XP_017831517
Ensembl: ENSCJAG00000020813
LinkDB
Position
9
AA seq 370 aa
MGLWALLPGWFSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDNASRVLYGNRGSNHASRAELLRLDREDPAHKPPSPHDLVYFEKSPKFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggctctgggcgctgttgcctggctggttttctgctacgctgctgctggcgctggcc
gctctgcccgcagccctggctgccaacagcagtggccgatggtggggtattgtgaacgta
gcctcctccacgaacctgctgacggactccaagagtctgcaactggtactcgagcccagt
ctgcagctgttgagccgcaaacagcggcgtctgatacgccaaaatccggggatcctgcac
agcgtgagcggggggctgcagagcgccgtgcgcgagtgcaagtggcagttccggaatcgc
cgctggaactgccccactgctccagggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgagaaacggcgtttatcttcgctatcacctccgcgggggtcacccattcggtggcg
cgctcctgctcagagggttccattgaatcctgcacatgtgattatcggcggcgcggcccc
gggggccccgactggcactgggggggctgcagcgacaacattgacttcggtcgcctcttt
ggccgggagttcgtggactccggggagaagggacgggacctgcgcttcctcatgaacctt
cacaacaacgaggcgggtcgcacgaccgtattctccgagatgcgccaggagtgcaagtgc
cacgggatgtccggctcgtgcacggtgcgcacgtgctggatgcggctgcccacgctgcgt
gccgtgggcgacgtgctgcgcgaccgcttcgacaacgcctcgcgcgtcctctacggcaac
cgcggcagcaaccacgcttcgcgggcggagctgctgcgcctggaccgggaagacccagcc
cacaaaccgccctccccccacgacctcgtctactttgagaaatcgcccaaattctgcacg
tacagcggacgcctgggtacagcgggcacggcagggcgcgcctgtaacagctcctcgccc
gcgctggacggctgcgagctgctctgctgcggcaggggccaccgcacgcgcacgcagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393646
Entry
100393646         CDS       T03264                                 

Gene name
WNT9B
Definition
(RefSeq) Wnt family member 9B
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100393646 (WNT9B)
   04390 Hippo signaling pathway
    100393646 (WNT9B)
   04150 mTOR signaling pathway
    100393646 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100393646 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100393646 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100393646 (WNT9B)
   05205 Proteoglycans in cancer
    100393646 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100393646 (WNT9B)
   05226 Gastric cancer
    100393646 (WNT9B)
   05217 Basal cell carcinoma
    100393646 (WNT9B)
   05224 Breast cancer
    100393646 (WNT9B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100393646 (WNT9B)
   05022 Pathways of neurodegeneration - multiple diseases
    100393646 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100393646 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100393646 (WNT9B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100393646 (WNT9B)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100393646 (WNT9B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100393646
NCBI-ProteinID: XP_008995078
Ensembl: ENSCJAG00000020024
UniProt: F6W1Q6
LinkDB
Position
5
AA seq 357 aa
MRPPPALALAGFCLLVLRAAAASYFGLTGREVLTPFPGLGTAAAPAQDRAHLKQCDLLKL
SRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRDERWNCSLEGRMGLLKRGFKETAFLY
AVSSAALTHALARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSK
KGSKDLRAQADAHNTHVGIKAVKSGHRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKL
CYDSAIKVSSATNEALGRLELWAPARQGSLAQDLAPRSGDLVYMEDSPSFCRPSKFSPGT
AGRVCSREASCSSLCCGRGYDTQSRLVAFSCRCQVQWCCYVECQECVEEELVYTCKH
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgcgccccccgcccgcgctggccctggccgggttctgcctgctggtgctgcgcgccgcc
gccgcctcctatttcggcctgactgggcgggaggtcctgacgcccttcccaggactgggc
actgcggcggcgccggcacaggaccgggcccacctgaagcagtgcgacctgctgaagctg
tcccggcggcagaagcagctgtgccggagggagcccggcctggctgagaccctgcgggat
gctgcgcacctcggcctgctcgagtgccaattccagtttcgggacgagcgctggaactgc
agcctggagggcaggatgggcctgctcaagagaggtttcaaagagacggccttcctgtat
gcagtgtcctctgccgccctcacccacgccctggcccgggcctgcagtgctgggcgcatg
gagcgctgcacctgtgatgactctccagggctggagagccggcaggcctggcagtggggc
gtgtgcggtgacaacctcaagtacagcaccaagtttctgagcaacttcctggggtccaag
aaaggaagcaaggacctgagggcacaggcagatgcccacaacacccacgtgggcatcaag
gcggtgaagagtggccacaggaccacgtgtaagtgccatggcgtgtcaggctcttgtgcc
gtgcgcacctgttggaagcagctctccccattccgtgagacgggccaggtgctgaagcta
tgctacgactcagctatcaaggtgtccagtgccaccaatgaggccttgggccgcctagag
ctatgggcccctgccaggcagggcagcctcgcccaagacctggccccgaggtctggggac
ctggtgtacatggaggactcacccagcttctgccggcccagcaagttctcaccgggcacg
gcgggcagggtgtgctcccgggaggccagctgcagcagcctgtgctgcgggcggggctat
gacacccagagccgcttggtggccttctcctgccgctgtcaggtgcaatggtgctgctac
gtggagtgccaggagtgcgtggaggaggagcttgtgtacacctgcaagcactag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394855
Entry
100394855         CDS       T03264                                 

Gene name
WNT6
Definition
(RefSeq) Wnt family member 6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100394855 (WNT6)
   04390 Hippo signaling pathway
    100394855 (WNT6)
   04150 mTOR signaling pathway
    100394855 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100394855 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100394855 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100394855 (WNT6)
   05205 Proteoglycans in cancer
    100394855 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100394855 (WNT6)
   05226 Gastric cancer
    100394855 (WNT6)
   05217 Basal cell carcinoma
    100394855 (WNT6)
   05224 Breast cancer
    100394855 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100394855 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    100394855 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100394855 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100394855 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100394855 (WNT6)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100394855 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100394855
NCBI-ProteinID: XP_002749844
Ensembl: ENSCJAG00000011399
UniProt: A0A5F4VXK1
LinkDB
Position
6
AA seq 365 aa
MLPPARSSLGLLLLLLLCPTHVGGLWWAVGSPLVMDPISICRKARRLAGWQAELCQAEPE
VVEELARGARLGVRECQFQFRFRRWNCSSNSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSLGELLQCGCQAPRGWVPPQPSGLPGTPGPPGPAGSLEGSVAWEWGGCGDDVDYGD
EKSRLFMDARDNRGRGDMRALVQLHNNEAGRLAVRSQTRTECKCHGLSGSCALRTCWQKL
PPFREVGALLLERFHGASRVMGTNDGKALLPAVRTLKPPDRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQFEENCLCRFQWCCVVQCHRCSVLRQ
LTLCL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctccctccagcgcgctccagcctagggctgctgctgctgctgctcctgtgcccgacg
cacgtcggcggactgtggtgggctgtgggcagccccttggttatggaccctatcagcatc
tgcaggaaagcacggcggctggccggatggcaggccgagttgtgccaggctgagccggaa
gtggtggaggagctagcccggggcgcccggctcggggtgcgagagtgccagttccagttc
cgcttccgccgctggaactgctccagcaacagcaaggcctttggacgcatcctgcagcag
gacattcgggagacggccttcgtgtttgccatcactgcagcgggcgccagccacgccgtc
acgcaggcctgttccttgggcgagctgctgcagtgcggctgccaggcgccccgcgggtgg
gtcccgccccagccctccggcctgcctggcacccccggaccccctggccccgcgggctcc
ctggaaggcagcgtcgcctgggagtggggaggctgcggcgacgacgtggactacggggat
gagaagtcgaggctctttatggacgcgcgggacaatcggggacgcggagacatgcgcgcg
ttggtgcaactgcacaacaacgaggcaggccggctggccgtgcggagccagacgcgcacc
gagtgcaagtgccacgggctgtcgggctcgtgcgcgctacgcacctgctggcagaagcta
cctccgtttcgcgaagtgggcgcgctgctgctggagcgcttccacggcgcctcacgcgtc
atgggcaccaacgacggcaaggccctgctgcccgccgtccgcacgctcaagccgcctgac
cgagcggacctcctctacgccgccgactcgcccgacttctgcgcccccaaccgccgcacc
ggctcccctggcacgcgcggccgcgcctgcaatagcagcgccccagacctcagcggctgc
gacctgctgtgctgtggccgcgggcaccgccaggaaagcgtgcagttcgaggagaactgc
ctgtgccgcttccaatggtgctgcgtagtgcagtgccaccgctgcagcgtgctcaggcag
ctcaccctctgcctctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395222
Entry
100395222         CDS       T03264                                 

Gene name
WNT10A
Definition
(RefSeq) Wnt family member 10A
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100395222 (WNT10A)
   04390 Hippo signaling pathway
    100395222 (WNT10A)
   04150 mTOR signaling pathway
    100395222 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100395222 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100395222 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100395222 (WNT10A)
   05205 Proteoglycans in cancer
    100395222 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100395222 (WNT10A)
   05226 Gastric cancer
    100395222 (WNT10A)
   05217 Basal cell carcinoma
    100395222 (WNT10A)
   05224 Breast cancer
    100395222 (WNT10A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100395222 (WNT10A)
   05022 Pathways of neurodegeneration - multiple diseases
    100395222 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100395222 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100395222 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100395222 (WNT10A)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100395222 (WNT10A)
SSDB
Motif
Pfam: wnt Ebola_NP
Other DBs
NCBI-GeneID: 100395222
NCBI-ProteinID: XP_002749845
Ensembl: ENSCJAG00000011403
UniProt: F7GQE8
LinkDB
Position
6
AA seq 417 aa
MGSAHPRPWLRLRPQPQPRPALWVLLFFLLLLAAAMPRSAPNDILDLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYDS
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRSRFHRATLI
RPHNRNGGQLEPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGSDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcagcgcccaccctcgcccctggctgcggctccgtccccagccccagccgcggcca
gcgctctgggtgctcctgttcttcctactgctgctggctgctgccatgcccaggtcagca
cccaatgacattctggacctccgcctccccccggagcccgtgctcaatgccaacacggtg
tgcctaacgttgccaggcctgagccgcaggcaaatggaggtgtgtgtgcgtcaccctgac
gtggctgcctcagccatacagggcatccagatcgccatccacgaatgccaacaccaattc
cgggaccagcgctggaactgctcaagcctggagactcgaaacaagatcccctatgacagt
cccatcttcagcagaggtttccgagagagcgcttttgcctatgccatcgcggcagctggt
gtggtgcacgcggtgtccaatgcatgtgccctgggcaaactgaaggcctgtggctgcgac
gcgtcccggcgaggggatgaggaggccttccgtaggaagctgcaccgcctgcaactggac
gcactgcagcgtggtaagggcctgagccatggggtcccggaacacccagccctgcccaca
gccagcccaggcctgcaggactcctgggagtggggcggctgcagccccgacatgggcttc
ggggaacgcttctctaaggactttctggactctcgggagcctcacagagacatccatgcg
agaatgaggcttcacaacaaccgagtcgggaggcaggcggtgatggagaacatgcggcgg
aagtgcaagtgccacggcacgtcaggcagctgccagctcaagacgtgctggcaggtgacg
ccggagtttcgcaccgtgggggcgctgctgcgcagccgcttccaccgcgccacgctcatc
cggccgcacaaccgcaacggcggccagctggagccaggcccagcgggggcaccctcgccc
gctccgggcgctcccgggccgcgccgccgggctagccccgccgacctggtctactttgag
aagtcgcccgacttctgcgagcgcgagccgcgcctggactcggcgggcaccgtgggccgc
ctgtgcaacaagagcagcgcgggctcggatggctgcggcagcatgtgctgcggtcgcggc
cacaacatcctgcgccagacgcgcagcgagcgctgccactgccgtttccactggtgctgt
ttcgtggtctgcgaagagtgccgcatcaccgagtgggtcagcgtctgcaagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100395234
Entry
100395234         CDS       T03264                                 

Gene name
WNT2B
Definition
(RefSeq) Wnt family member 2B
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100395234 (WNT2B)
   04390 Hippo signaling pathway
    100395234 (WNT2B)
   04150 mTOR signaling pathway
    100395234 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100395234 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100395234 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100395234 (WNT2B)
   05205 Proteoglycans in cancer
    100395234 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100395234 (WNT2B)
   05226 Gastric cancer
    100395234 (WNT2B)
   05217 Basal cell carcinoma
    100395234 (WNT2B)
   05224 Breast cancer
    100395234 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100395234 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    100395234 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100395234 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100395234 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100395234 (WNT2B)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100395234 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100395234
NCBI-ProteinID: XP_002751275
Ensembl: ENSCJAG00000013473
UniProt: A0A2R8MND7
LinkDB
Position
7
AA seq 391 aa
MLRPGGAEEAAQLPIRRARAPVPVPSPRPAAPDGSGASARLGLACLLLLLTLPDRVDTSW
WYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTT
VDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQR
GDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCH
GVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRHATRTDLV
YFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFH
WCCAVRCKECRDIVDVHTCKAPKKAEWLDQT
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgctgagaccgggtggtgcggaggaagctgcgcagctccccattcggcgcgcccgcgcc
ccggtcccggtgccctcccccagacccgcggcccccgacggctccggggcttcggcccgc
ctgggtcttgcctgccttctgctcctgctgacgctgccagaccgcgtagacacgtcctgg
tggtacattggggcactgggggcccgagtgatctgtgacaatatccctggtttggtgagc
cggcagcggcagctgtgccagcgttacccagacatcatgcgttcagtgggcgagggtgcc
cgagaatggatccgagagtgtcaacaccaattccgccaccatcgctggaactgtaccacc
gtggaccgggaccacactgtctttggccgtgtcatgctcagaagtagccgagaggcagct
ttcgtatatgccatctcatcagcaggagtagtccacgctattactcgtgcctgtagccag
ggtgaactaagtgtgtgcagctgtgacccgtacacccgtggccgacaccatgaccagcgt
ggggactttgactggggtggctgcagtgacaacatccactatggtgtccgttttgcgaag
gccttcgtagatgccaaggagaagaggcttaaggatgcccgggccctcatgaacttacat
aataaccgctgcggtcgcacggctgtgcggcgatttctgaagctggagtgtaagtgccat
ggcgtgagtggttcctgtactctgcgcacctgctggcgtgcactctcagatttccgccgc
acaggtgattacctgcggcggcgctatgatggggctgtgcaggtgacggccacccaggat
ggtgccaacttcactgcagcccgccaaggctatcgccatgccactcggactgatcttgtc
tactttgacaactccccagattactgtgtcttggacaaggctgcaggttccctaggcact
gcaggccgtgtctgcagcaagacatcaaaaggaacagatggttgtgaaatcatgtgctgt
ggccgagggtacgacacaactcgagtcacccgtgttacccagtgtgagtgcaaattccac
tggtgctgcgctgtgcggtgcaaggaatgcagagacattgtggacgtccatacttgcaag
gcccccaagaaggcagagtggctggaccagacctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397032
Entry
100397032         CDS       T03264                                 

Gene name
WNT9A
Definition
(RefSeq) Wnt family member 9A
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100397032 (WNT9A)
   04390 Hippo signaling pathway
    100397032 (WNT9A)
   04150 mTOR signaling pathway
    100397032 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100397032 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100397032 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100397032 (WNT9A)
   05205 Proteoglycans in cancer
    100397032 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100397032 (WNT9A)
   05226 Gastric cancer
    100397032 (WNT9A)
   05217 Basal cell carcinoma
    100397032 (WNT9A)
   05224 Breast cancer
    100397032 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100397032 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    100397032 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100397032 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100397032 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100397032 (WNT9A)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100397032 (WNT9A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100397032
NCBI-ProteinID: XP_008989638
LinkDB
Position
Un
AA seq 365 aa
MLDGPPLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTVLPLTLEPEAAAQAHYKACD
RLKLERKQRRMCRRDPGVAETLLEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFK
ETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVK
EFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVG
KHLKHKYETALKVGSITNEAAGEAGAISPPRGRVSGAGGGDPLPRTLELVHLDDSPSFCL
AGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEV
YTCKG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctggatgggcccccgctggcgcgctggctggccgcggccttcgggctgacgctgctg
ctcgccgcgctgcgcccttcggccgcctacttcgggctgacgggcagcgagcccctgacc
gtcctcccgctgaccctggagcccgaggcggccgcccaggcgcactacaaggcctgcgac
cggctgaagctggagcggaagcagcggcgcatgtgccgccgggacccgggcgtggcggag
acgctgctggaggccgtgagcatgagcgcgctggagtgccagttccagttccgctttgag
cgctggaactgcacgctggagggccgctaccgggccagcctgctcaagagaggcttcaag
gagaccgccttcctctatgccatctcctcggctggcctgacccacgcactggccaaggca
tgcagcgcgggccgcatggagcgctgtacctgtgatgaggcgcccgacctggagaaccgc
gaggcctggcagtgggggggctgcggggacaacctcaagtacagcagcaagttcgtcaag
gagttcctgggccggcggtccagcaaggatctgcgagcccgcgtggacttccacaacaac
ctcgtgggtgtgaaggtgatcaaggccggggtggagaccacctgcaagtgccacggtgtg
tcaggctcctgcacggtgcggacctgctggcggcagctggcgcccttccacgaggtgggc
aagcacctgaagcacaagtatgagacggcgctcaaggtgggcagcattaccaacgaggct
gccggcgaggcaggcgccatctccccgccgcgaggccgcgtctcaggggcggggggtggt
gacccgctgccccgcactctggagcttgtgcacttggacgactcacccagcttctgcctg
gccggccgcttctccccaggcaccgctggccgcaggtgccaccgcgagaagaactgcgag
agcatctgctgcggtcgcggccataacacacagagccgggtggtgacgaggccctgccag
tgtcaggtgcgctggtgctgctacgtggagtgccggcagtgcacgcagcgcgaggaggtc
tacacctgcaagggctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398579
Entry
100398579         CDS       T03264                                 

Gene name
WNT3
Definition
(RefSeq) Wnt family member 3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100398579 (WNT3)
   04390 Hippo signaling pathway
    100398579 (WNT3)
   04150 mTOR signaling pathway
    100398579 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100398579 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100398579 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100398579 (WNT3)
   05206 MicroRNAs in cancer
    100398579 (WNT3)
   05205 Proteoglycans in cancer
    100398579 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100398579 (WNT3)
   05226 Gastric cancer
    100398579 (WNT3)
   05217 Basal cell carcinoma
    100398579 (WNT3)
   05224 Breast cancer
    100398579 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100398579 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    100398579 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100398579 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100398579 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100398579 (WNT3)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100398579 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100398579
NCBI-ProteinID: XP_002748199
Ensembl: ENSCJAG00000020014
UniProt: F7AN74
LinkDB
Position
5
AA seq 355 aa
MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECVRVYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctcctcggcctcctgctcggtggcaccagggtcctc
gccggctacccaatttggtggtccctggccctgggtcagcagtacacatctctgggctca
cagcccctgctctgcggctccatcccaggcctggtccccaagcaactgcgcttctgccgc
aattacatcgagattatgcccagcgtggccgagggtgtgaagctgggcatccaggagtgc
cagcaccagttccggggccgccgctggaactgcaccaccatagatgacagcctggccatc
tttgggcccgtccttgacaaagccacccgcgagtcggcctttgtccatgccatcgcctcg
gccggagtggcctttgcggtcacccgctcctgcgctgagggcacctccaccatctgcggc
tgtgactcgcatcataaagggccgcctggcgaaggctggaagtggggcggctgcagcgag
gacgctgacttcggggtgctagtgtccagggagtttgcggatgcgcgtgagaacaggccg
gacgcgcgctcggccatgaacaagcacaacaatgaagcgggccgcacgactatcctggac
cacatgcacctcaaatgcaagtgccacgggctgtcgggcagctgtgaggtgaagacctgc
tggtgggcccagcctgacttccgtgccatcggcgacttcctcaaggacaagtatgacagc
gcctcagagatggtggtggaaaagcaccgtgagtcccggggctgggtggagactctccgg
gccaagtactctctcttcaagccgcccaccgagagggacctggtctactacgagaactcc
cccaacttttgtgagcccaacccagagacgggttccttcggcacaagggaccggacttgc
aatgtcacctcccatggcatcgatggctgtgacctgctctgctgtggccgtggccacaac
acgaggacggagaagcggaaggaaaagtgccactgcatcttccactggtgctgctacgtc
agctgccaagagtgtgttcgcgtctacgacgtgcacacctgcaaatag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398625
Entry
100398625         CDS       T03264                                 

Gene name
WNT11
Definition
(RefSeq) Wnt family member 11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100398625 (WNT11)
   04390 Hippo signaling pathway
    100398625 (WNT11)
   04150 mTOR signaling pathway
    100398625 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100398625 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100398625 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100398625 (WNT11)
   05205 Proteoglycans in cancer
    100398625 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100398625 (WNT11)
   05226 Gastric cancer
    100398625 (WNT11)
   05217 Basal cell carcinoma
    100398625 (WNT11)
   05224 Breast cancer
    100398625 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100398625 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    100398625 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100398625 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100398625 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100398625 (WNT11)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100398625 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100398625
NCBI-ProteinID: XP_002754856
Ensembl: ENSCJAG00000015296
UniProt: U3F5E7
LinkDB
Position
11
AA seq 354 aa
MRARPQVCEALLFALALQTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLQLMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHTIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELQDVAADLKIR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELIYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggccgcaggtctgcgaggcgctgctctttgcccttgcgctccagaccggc
gtgtgctatggcatcaagtggctggcgctgtccaagacaccagcggccctggcgctgaac
cagacgcaacactgcaagcagctggagggcctggtgtctgcgcaggtgcagctgtgccgc
agcaacctgcagctcatgcacacggttgtgcacgccgcccgcgaggtcatgaaggcctgc
cgccgggccttcgccgacatgcgctggaactgctcctccatcgagctcgcccccaactat
ttgcttgacctggagagagggacccgggagtcagccttcgtgtatgctctgtcggctgcc
gccatcagccacaccatcgcccgggcctgcacctctggcgacctgcccggctgctcctgc
ggccctgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgcgcctctttggaaatgaagtgtaagtgccatggggtgtctggctcctgctccatc
cgcacctgctggaaggggttgcaggagctgcaggatgtggctgccgatcttaagattcga
tacttgtccgccaccaaggtagtgcaccgtcccatgggcacccgcaagcacctggtgccc
aaggacctggatatccggcctgtgaaggactcggaacttatctatctgcagagctcacct
gacttctgcatgaagaatgagaaggtgggctcccatgggacacaagacaggcagtgcaac
aagacatccaacggcagtgacagctgcgaccttatgtgctgcgggcgtggctacaacccc
tacacagaccgcgtggtcgagcggtgccactgtaagtaccactggtgctgctacgtcacc
tgccgcaggtgtgagcgcactgtggagcgctatgtatgcaagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401066
Entry
100401066         CDS       T03264                                 

Gene name
WNT5A
Definition
(RefSeq) Wnt family member 5A
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04360  Axon guidance
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100401066 (WNT5A)
   04390 Hippo signaling pathway
    100401066 (WNT5A)
   04150 mTOR signaling pathway
    100401066 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100401066 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100401066 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    100401066 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100401066 (WNT5A)
   05205 Proteoglycans in cancer
    100401066 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100401066 (WNT5A)
   05226 Gastric cancer
    100401066 (WNT5A)
   05217 Basal cell carcinoma
    100401066 (WNT5A)
   05224 Breast cancer
    100401066 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100401066 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    100401066 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100401066 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100401066 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100401066 (WNT5A)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100401066 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100401066
NCBI-ProteinID: XP_002758487
Ensembl: ENSCJAG00000007750
UniProt: F7I9H1
LinkDB
Position
15
AA seq 380 aa
MKKSIGILSPGVALGMAGSAMSSKFFLMALAIFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagaagtccattggaatattaagcccaggagttgctttggggatggctggaagtgca
atgtcttccaagttcttcctaatggctttggccatatttttctccttcgcccaggttgta
atagaagccaattcttggtggtcgctaggtatgaataaccctgttcagatgtcagaagta
tatatcataggagcacagcctctctgcagccaactggcaggactttctcaaggacagaag
aaactgtgccacttgtatcaggaccacatgcagtacattggagaaggcgcgaagacaggc
atcaaagaatgccagtatcaattccgacatcgaaggtggaactgcagcactgtggataac
acctctgtttttggcagggtgatgcagataggcagccgcgagacggccttcacgtacgcg
gtgagcgcggcgggggtggtgaacgccatgagccgggcgtgccgcgagggcgagctgtcc
acctgcggctgcagccgcgccgcgcgtcccaaggacctgccgcgggactggctctggggc
ggctgcggtgacaacatcgactatggctaccgctttgccaaggagttcgtggacgcccgc
gagcgggagcgcatccacgccaagggctcctacgagagcgcgcgcatcctcatgaacctg
cacaacaacgaggcgggccgtaggacggtgtacaatctggctgatgtggcctgcaagtgc
catggggtgtccggctcatgtagcctcaagacatgctggctgcagctggcggacttccgc
aaggtgggtgatgccctgaaggagaagtacgacagcgcggcggccatgcggctcaacagc
cggggcaagttggtgcaggtcaacagccgcttcaactcacccaccacacaggacctggtc
tacatcgaccccagccctgactactgcgtgcgcaacgagagcacgggctcgctgggcacg
cagggccgcctgtgcaacaagacatcagagggcatggatggctgtgagctcatgtgctgc
ggccgcggctacgaccagttcaaaacggtgcagacggagcgctgccactgcaagttccac
tggtgctgctatgtcaagtgcaagaagtgcacggagatcgtggaccagttcgtgtgcaag
tag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402422
Entry
100402422         CDS       T03264                                 

Gene name
WNT8A
Definition
(RefSeq) Wnt family member 8A
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100402422 (WNT8A)
   04390 Hippo signaling pathway
    100402422 (WNT8A)
   04150 mTOR signaling pathway
    100402422 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100402422 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100402422 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100402422 (WNT8A)
   05205 Proteoglycans in cancer
    100402422 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100402422 (WNT8A)
   05226 Gastric cancer
    100402422 (WNT8A)
   05217 Basal cell carcinoma
    100402422 (WNT8A)
   05224 Breast cancer
    100402422 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100402422 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    100402422 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100402422 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100402422 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100402422 (WNT8A)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100402422 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100402422
NCBI-ProteinID: XP_002744240
Ensembl: ENSCJAG00000006245
LinkDB
Position
2
AA seq 355 aa
MGNLFVLWAAVGICCATFSVSAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAW
ERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYTITKNCSMGDFENCGCDESRNG
KTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRAALKRTC
KCHGISGSCSVQTCWLQLADFREMGDYLKAKYDRALKIEMDKRQLRAGNSAESHWAPSEA
FLPSAETELIFLEESPDYCTHNSSLGIYGTEGRECLQNSHNTSRWERCSCGSLCTECGLQ
VEERRTEVISSCNCKFQWCCTVKCDQCRDMVKKYYCSRSSGSAQSLGKVWFGVPI
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggggaacctgtttgtgctctgggcagctgtgggcatatgctgtgccacattcagtgtc
tccgcctggtcagtgaacaatttcctgataacaggtcccaaggcttatctgacctacaca
actagcgtggccttaggtgcccagagtggcattgaggagtgcaagttccagtttgcttgg
gaacgctggaactgccctgaaaatgctctccagctctccacccacaacaggctgagaagt
gccaccagagagacttccttcatacatgctatcagctctgctggagtcatgtacaccatc
accaagaactgtagcatgggtgacttcgaaaactgtggctgtgatgagtcaagaaatgga
aaaacaggaggccatggctggatctggggaggctgcagcgacaatgtggaatttggggaa
aggatctccaaactctttgtggacagtttggagaaggggaaggatgccagagccctgatg
aatcttcacaataacagggccggcagactggcagtgagagccgccttgaaaaggacctgc
aaatgccatggcatctccgggagctgcagcgtacagacatgctggctgcagctagctgac
ttccgggagatgggagactacctgaaggccaagtatgaccgggcactgaaaattgaaatg
gataagcggcaactgagagctgggaacagtgccgagagccactgggcaccctctgaggcc
ttccttcctagtgcagagacggaactgatctttttagaggaatcaccagattactgtacc
cataattccagcctaggcatctatggcacagagggtcgtgagtgcctacagaacagccac
aacacatccaggtgggagcgatgtagctgtgggagcctgtgcactgagtgtggactgcag
gtggaagagaggagaactgaggtcataagcagctgtaactgcaaattccagtggtgctgt
acggtcaagtgtgaccagtgtagggatatggtgaagaagtattactgctcacgctcctca
ggcagtgcccagtccctggggaaagtttggtttggggtccctatctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405273
Entry
100405273         CDS       T03264                                 

Gene name
WNT5B
Definition
(RefSeq) Wnt family member 5B
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04360  Axon guidance
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100405273 (WNT5B)
   04390 Hippo signaling pathway
    100405273 (WNT5B)
   04150 mTOR signaling pathway
    100405273 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100405273 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100405273 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    100405273 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100405273 (WNT5B)
   05205 Proteoglycans in cancer
    100405273 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100405273 (WNT5B)
   05226 Gastric cancer
    100405273 (WNT5B)
   05217 Basal cell carcinoma
    100405273 (WNT5B)
   05224 Breast cancer
    100405273 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100405273 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    100405273 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100405273 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100405273 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100405273 (WNT5B)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100405273 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100405273
NCBI-ProteinID: XP_003733754
Ensembl: ENSCJAG00000000677
LinkDB
Position
9
AA seq 358 aa
MPSLLLLFTAALLSSWVQLLIEANSWWSLAMNPVQRPEMFIIGAQPVCSQLPGLSPGQRK
LCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCSTVDNASVFGRVMQIGSRETAFTYAV
SAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARE
REKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRK
VGDRLKEKYDSAAAMRITRKGRLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQ
GRLCNKTSEGMDGCELMCCGRGYNQFKSMQVERCHCKFHWCCFVKCKKCAEIVDQYCK
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcccagcctgctgctgctgttcacagctgctctgctgtccagctgggttcagcttctg
atagaagccaactcctggtggtcattagctatgaacccggtgcagagacccgagatgttt
atcatcggtgcccagcctgtgtgcagccagcttcctgggctctcccctggccagaggaag
ctgtgccaattgtaccaggagcacatggcctacataggggagggagccaagacaggcatc
aaggaatgccagcaccagttccggcagcggcggtggaactgcagcacagtggacaacgcg
tctgtctttgggagagtcatgcagataggtagccgagagaccgctttcacctacgcggtg
agcgccgcgggcgtggtcaacgccatcagccgggcctgccgcgagggcgagctctcgacc
tgtggctgcagcaggacggcgcggcccaaggacctgccccgggactggctgtggggcggc
tgtggggacaatgtggagtacggctaccgcttcgcaaaggagttcgtggatgcccgggag
cgagagaagaactttgctaagggatcggaggagcagggccgcgtgctcatgaacctgcag
aacaacgaggcgggtcgcagggctgtgtataagatggcagatgtagcctgcaaatgccac
ggcgtctcggggtcctgcagcctcaagacctgctggctgcagctggccgagttccgcaag
gtaggggaccggctgaaggagaagtacgacagtgcggccgcaatgcgcatcacccgaaag
ggccggctggagctggtcaacagccgcttcacccagcccactccagaggaccttgtgtac
gtggaccccagccctgactactgcctgcgcaatgagagcacgggctccctgggcacgcag
ggccgcctttgcaacaaaacctcagagggcatggacggctgtgagctcatgtgctgcggc
cgaggctacaaccagttcaagagcatgcaggtggagcgctgccactgcaagttccactgg
tgctgcttcgtcaagtgcaagaagtgcgctgagatcgtggaccagtactgcaaatag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411308
Entry
100411308         CDS       T03264                                 

Gene name
WNT2
Definition
(RefSeq) Wnt family member 2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100411308 (WNT2)
   04390 Hippo signaling pathway
    100411308 (WNT2)
   04150 mTOR signaling pathway
    100411308 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100411308 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100411308 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100411308 (WNT2)
   05205 Proteoglycans in cancer
    100411308 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100411308 (WNT2)
   05226 Gastric cancer
    100411308 (WNT2)
   05217 Basal cell carcinoma
    100411308 (WNT2)
   05224 Breast cancer
    100411308 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100411308 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    100411308 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100411308 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100411308 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100411308 (WNT2)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100411308 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100411308
NCBI-ProteinID: XP_002751822
Ensembl: ENSCJAG00000004983
UniProt: Q2QLG1 U3E233
LinkDB
Position
8
AA seq 360 aa
MNSPLRGIWLWLPLLLTWLTPEVSSSWWYMGATGGSSRVMCDNVPGLVSSQRQLCHRHPD
VMRAIGLGVTEWTSECQYQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAVTRACSQGEVKSCSCDPKKMGSGKDSKGVFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKSVKRFLKQECKCHGVSGSCSLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDRETGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMIKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWKSPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaactcccctctccgtggaatctggctctggctccctctgctcttgacctggctcacc
cccgaggtcagctcttcatggtggtacatgggagctacaggtggctcctccagggtgatg
tgtgataatgtgccaggcctggtgagcagccagcggcagctgtgtcaccgacacccagat
gtgatgcgtgccattggcctgggcgtgaccgagtggacttcggaatgccagtaccagttc
cgccagcaccgctggaattgcaacactctggacagggatcacagcctctttggcagggtc
ctactccgaagtagtcgggaatctgcctttgtttatgccatctcctcagctggagtcgta
tttgccgtcaccagggcctgtagccaaggagaagtaaaatcctgttcctgtgatccaaag
aagatgggaagtggcaaggacagcaagggcgtttttgattggggtggctgcagtgataac
attgactatgggatcaagtttgcccgcgcatttgtggatgccaaggagaggaaaggaaag
gatgccagagccctgatgaatcttcataacaacagagctggcaggaagtctgtaaagcgg
ttcttgaaacaagagtgcaagtgccacggggtgagcggctcgtgttctctcaggacatgc
tggctggccatggccgacttcaggaaaacgggagattatctctggaggaagtacaatggg
gccatccaggtggtcatgaaccaggatggcacaggtttcactgtggctaacgagaggttt
aagaagccaacaaaaaatgacctcgtgtattttgagaattctccagactactgtatcagg
gaccgagagacaggctccctgggtacagcaggccgtgtgtgcaacctgacttcccggggc
atggacagctgtgaagtcatgtgctgtggaagaggctacgacacctcccatgtcacccgg
atgatcaagtgtgggtgtaagttccactggtgctgtgccgtgcgctgtcaggactgcctg
gaagccctggacgtgcacacatgcaaggcacccaagaacgctgactggaaaagccccaca
tga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414221
Entry
100414221         CDS       T03264                                 

Gene name
WNT7B
Definition
(RefSeq) Wnt family member 7B
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100414221 (WNT7B)
   04390 Hippo signaling pathway
    100414221 (WNT7B)
   04150 mTOR signaling pathway
    100414221 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100414221 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100414221 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100414221 (WNT7B)
   05205 Proteoglycans in cancer
    100414221 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100414221 (WNT7B)
   05226 Gastric cancer
    100414221 (WNT7B)
   05217 Basal cell carcinoma
    100414221 (WNT7B)
   05224 Breast cancer
    100414221 (WNT7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100414221 (WNT7B)
   05022 Pathways of neurodegeneration - multiple diseases
    100414221 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100414221 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100414221 (WNT7B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100414221 (WNT7B)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100414221 (WNT7B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100414221
NCBI-ProteinID: XP_002743897
Ensembl: ENSCJAG00000012866
UniProt: U3BHR4
LinkDB
Position
1
AA seq 349 aa
MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAII
VIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVT
AACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLM
NLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEV
VRASRLRQPTFLRIKQLRSYQKPMETELVYIEKSPNYCEEDAATGSVGTQGRLCNRTSLG
ADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVRCNSCSERTEVFTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcacagaaacttccgcaagtggattttctacgtgtttctctgctttggcgtcctctac
gtgaagctcggagcattgtcatccgtggtggccctgggagccaacatcatctgcaacaag
attcccggcctcgccccgcggcagcgtgccatctgccagagccgacccgatgccatcatt
gtgattggggagggggcacagatgggcatcaatgagtgccagtaccagttccgttttgga
cgctggaactgctctgcccttggcgagaagaccgtcttcgggcaagagctccgagtaggg
agccgcgaggctgccttcacatacgccatcaccgcggctggcgtagcgcacgctgtcacc
gcggcttgcagccaaggcaacctgagcaactgcggctgcgaccgtgagaagcagggttac
tataaccaggccgagggctggaagtggggcggctgctccgccgacgtgcgctacggcatc
gacttctcccggcgcttcgtggacgcgcgggagatcaagaagaatgcgcggcgcctcatg
aacctgcacaacaacgaggccggcaggaaggttctggaggaccggatgcagctggagtgc
aagtgccacggcgtgtctggctcctgcaccaccaagacctgctggaccacgctgcccaag
ttccgagaggtgggccacctgctgaaggagaagtacaacgcggccgtgcaggtggaggtg
gtgcgggccagccgcctgcggcagcccaccttcctgcgcatcaagcagctgcgaagctat
cagaagcccatggagacggagctggtgtacatcgagaagtcgcccaactactgcgaggag
gacgcagccacaggcagcgtgggcacgcagggccgcctctgcaaccgcacctcgctcggc
gcggacggctgtgacaccatgtgctgcggccgcggctacaacacccaccagtacaccaag
gtgtggcagtgcaactgcaagttccactggtgctgcttcgtcaggtgcaacagctgcagc
gagcgcaccgaggtcttcacctgcaagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414921
Entry
100414921         CDS       T03264                                 

Gene name
WNT8B
Definition
(RefSeq) Wnt family member 8B
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100414921 (WNT8B)
   04390 Hippo signaling pathway
    100414921 (WNT8B)
   04150 mTOR signaling pathway
    100414921 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100414921 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100414921 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100414921 (WNT8B)
   05205 Proteoglycans in cancer
    100414921 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100414921 (WNT8B)
   05226 Gastric cancer
    100414921 (WNT8B)
   05217 Basal cell carcinoma
    100414921 (WNT8B)
   05224 Breast cancer
    100414921 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100414921 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    100414921 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100414921 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100414921 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100414921 (WNT8B)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate / Heparin
  Morphogens
   100414921 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100414921
NCBI-ProteinID: XP_009008403
Ensembl: ENSCJAG00000017341
UniProt: A0A2R8M5J2
LinkDB
Position
12
AA seq 351 aa
MFPSKPSVYISLFTCVLQLSHSWSMNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAW
DRWNCPERALQLSSYGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG
QLGGQGWLWGGCSDNVGFGETISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTC
KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGASNSAASRGAIANTFRS
ISTRELVHLEDSPDYCLENKTLGLLGTEGRECLKRGRALGRWERRSCRRLCGDCGLAVEE
RRAETVSSCNCKFHWCCAVRCEQCRRKITKYFCSRVERPRGGAAHKPGRKP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtttccttcaaagccttctgtgtacatctctctttttacctgtgtcctccaactcagc
cacagctggtcaatgaacaatttcctgatgactggtccaaaggcttacctgatttattcc
agcagtgtggcagctggtgcccagagtggtattgaagaatgcaagtatcagtttgcctgg
gaccgctggaactgccctgagagagccctgcagctgtccagctatggcgggcttcgcagt
gctaatcgggagacagcatttgtgcatgccatcagttctgctggagtcatgtacaccctg
actagaaactgcagccttggagattttgataactgtggctgtgatgactcccgcaatggg
caactggggggccaaggctggctgtggggaggctgcagtgacaatgtgggcttcggagag
acgatttctaagcagtttgtcgatgccctggaaacaggacaggatgcacgggcagccatg
aacctgcacaacaacgaagctggccgcaaggcggtgaagggcaccatgaaacgcacgtgc
aagtgccacggcgtgtctggcagctgcaccacgcagacctgttggctgcagctgcccgag
ttccgcgaagtgggcgcgcacctgaaggagaagtaccacgcggcactcaaggtggacctg
ctgcagggtgctagcaacagcgcggccagccgcggcgctatcgccaacacctttcgctcc
atctccactcgggagctggtgcacctggaggactccccagactactgcttggagaacaaa
actctagggctgctgggcaccgaaggccgagagtgcctgaagcgcgggcgcgccctgggt
cgctgggaacgccgcagctgccgccggctctgcggggactgcgggctggccgtggaggag
cgccgggcggagactgtgtccagctgcaactgcaagttccactggtgctgcgcagtccgc
tgcgagcagtgccgccggaagatcaccaagtatttctgtagccgcgtggagcggccgcgc
gggggcgctgcgcacaaacctgggagaaaaccctaa

DBGET integrated database retrieval system