KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100386168
Entry
100386168         CDS       T03264                                 

Gene name
MAP2K4
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04620  Toll-like receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04668  TNF signaling pathway
cjc04912  GnRH signaling pathway
cjc04926  Relaxin signaling pathway
cjc04935  Growth hormone synthesis, secretion and action
cjc05132  Salmonella infection
cjc05135  Yersinia infection
cjc05142  Chagas disease
cjc05161  Hepatitis B
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100386168 (MAP2K4)
   04012 ErbB signaling pathway
    100386168 (MAP2K4)
   04668 TNF signaling pathway
    100386168 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100386168 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    100386168 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100386168 (MAP2K4)
   04926 Relaxin signaling pathway
    100386168 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    100386168 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100386168 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100386168 (MAP2K4)
   05135 Yersinia infection
    100386168 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100386168 (MAP2K4)
   05161 Hepatitis B
    100386168 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100386168 (MAP2K4)
   05169 Epstein-Barr virus infection
    100386168 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100386168 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100386168 (MAP2K4)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100386168 (MAP2K4)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  STE7 family
   100386168 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100386168
NCBI-ProteinID: XP_002747945
Ensembl: ENSCJAG00000004752
UniProt: A0A2R8MIZ6
LinkDB
Position
5
AA seq 399 aa
MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARFT
LNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMV
HKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMEL
MSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRS
GNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYEL
ATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKE
LLKHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggcagcggcagcggcacc
ccgggccccgtagggtccccggcgccgggccacccggccgtcagcagcatgcagggtaaa
cgcaaagcactgaagttgaattttgcaaatccacctttcaaatctacagcaaggtttact
ctgaatcccaatcctacaggagttcaaaacccacacatagagagactgagaacacacagc
attgagtcatcaggaaaactgaagatctcccctgaacaacactgggatttcactgcagag
gacttgaaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatggtc
cacaaaccaagtgggcaaataatggcagttaaaagaattcggtcaacagtggatgaaaaa
gaacaaaaacaacttcttatggatttggatgtagtaatgcggagtagtgattgcccatac
attgttcagttttatggtgcactcttcagagagggtgactgttggatctgtatggaactc
atgtctacctcgtttgataagttttacaaatatgtatatagtgtattagatgatgttatt
ccagaagaaattttaggcaaaatcactttagcaactgtgaaagcactaaaccacttaaaa
gaaaacttgaaaattattcacagagatatcaaaccttccaatattcttctggacagaagt
ggaaatattaagctctgtgactttggcatcagtggacagcttgtggactctattgccaag
acaagagatgctggctgtcggccatacatggcacctgaaagaatagacccaagtgcatca
cgacaaggatatgacgtccgctctgatgtctggagtttggggatcacattgtatgagttg
gccacgggccgatttccttatccaaagtggaatagtgtatttgatcaactaacacaagtc
gtgaaaggagatcctccgcagctgagtaattctgaggagagggaattctccccaagtttc
atcaactttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtataaagag
cttctgaaacatccctttattctgatgtatgaagaacgtaccgttgaggtcgcatgctat
gtttgtaaaatcctggatcaaatgccagctactcccagctctcccatgtatgtcgattga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412930
Entry
100412930         CDS       T03264                                 

Gene name
MAP2K7
Definition
(RefSeq) mitogen-activated protein kinase kinase 7
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04141  Protein processing in endoplasmic reticulum
cjc04380  Osteoclast differentiation
cjc04530  Tight junction
cjc04620  Toll-like receptor signaling pathway
cjc04660  T cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04668  TNF signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04912  GnRH signaling pathway
cjc04926  Relaxin signaling pathway
cjc05010  Alzheimer disease
cjc05016  Huntington disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05132  Salmonella infection
cjc05135  Yersinia infection
cjc05161  Hepatitis B
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100412930 (MAP2K7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100412930 (MAP2K7)
   04012 ErbB signaling pathway
    100412930 (MAP2K7)
   04668 TNF signaling pathway
    100412930 (MAP2K7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100412930 (MAP2K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100412930 (MAP2K7)
   04660 T cell receptor signaling pathway
    100412930 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    100412930 (MAP2K7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100412930 (MAP2K7)
   04926 Relaxin signaling pathway
    100412930 (MAP2K7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100412930 (MAP2K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100412930 (MAP2K7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100412930 (MAP2K7)
   05016 Huntington disease
    100412930 (MAP2K7)
   05022 Pathways of neurodegeneration - multiple diseases
    100412930 (MAP2K7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100412930 (MAP2K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100412930 (MAP2K7)
   05135 Yersinia infection
    100412930 (MAP2K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100412930 (MAP2K7)
   05161 Hepatitis B
    100412930 (MAP2K7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100412930 (MAP2K7)
   05169 Epstein-Barr virus infection
    100412930 (MAP2K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100412930 (MAP2K7)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100412930 (MAP2K7)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: STE group
  STE7 family
   100412930 (MAP2K7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Seadorna_VP7 APH
Other DBs
NCBI-GeneID: 100412930
NCBI-ProteinID: XP_017823124
Ensembl: ENSCJAG00000006085
LinkDB
Position
22
AA seq 360 aa
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPMPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL
ENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV
QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALFYLKEKHGVI
HRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
IRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDW
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgggaggcccggcggaggatcgacctcaacctggatatcagcccacagcggcccagg
cccaccctgcagctcccgctggccaacgatgggggcagccgctcgccatcctccgagagc
tccccgcagcaccccatgccccccgcccggccccgccacatgttggggctcccgtcaacc
ctgttcacgccccgcagcatggagagcattgagattgaccagaagctgcaggagatcatg
aagcagacgggctacctgaccatcggaggccagcgctaccaggcagaaatcaatgacctg
gagaacttgggcgagatgggcagcggcacctgtggccaggtgtggaagatgcgcttccgg
aagacgggccatgtcattgccgtcaagcaaatgcggcgctcggggaacaaggaggagaac
aagcgcatcctcatggacctagacgtggtgctcaagagccatgactgcccctacatcgtg
cagtgcttcgggaccttcatcaccaacacagacgtcttcattgccatggagctcatgggc
acctgcgctgagaagctcaagaagcggatgcagggccccatccccgagcgaatcctgggc
aagatgacagtggcgattgtgaaggcgctgttctacctgaaggagaagcatggtgtcatc
caccgcgacgtcaagccctccaacatcctgctggatgagcggggtcagatcaagctctgc
gacttcggcatcagcggccgcctggtggactccaaagccaagactcggagcgcaggctgt
gccgcctacatggcccccgagcgcatcgaccccccagaccccaccaagcctgactatgac
atccgggctgacgtgtggagcctgggcatctcattggtggagctggcaacaggacagttt
ccttacaagaactgcaagacggactttgaggtcctcaccaaagtcctgcaggaggagccc
ccgcttctgcctggacacatgggtttctcaggggacttccagtccttcgtcaaagactgg
tga

DBGET integrated database retrieval system