KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387077
Entry
100387077         CDS       T03264                                 

Gene name
FZD6
Definition
(RefSeq) frizzled class receptor 6
  KO
K02376  frizzled 6
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100387077 (FZD6)
   04390 Hippo signaling pathway
    100387077 (FZD6)
   04150 mTOR signaling pathway
    100387077 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100387077 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100387077 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100387077 (FZD6)
   05205 Proteoglycans in cancer
    100387077 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100387077 (FZD6)
   05226 Gastric cancer
    100387077 (FZD6)
   05217 Basal cell carcinoma
    100387077 (FZD6)
   05224 Breast cancer
    100387077 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100387077 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    100387077 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100387077 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100387077 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100387077 (FZD6)
G protein-coupled receptors [BR:cjc04030]
 Frizzled / Smoothened family
  100387077 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec Integrin_alpha RseC_MucC
Other DBs
NCBI-GeneID: 100387077
NCBI-ProteinID: XP_008981636
Ensembl: ENSCJAG00000016150
LinkDB
Position
16
AA seq 706 aa
MEMFTFWLTCIFLPLVRGHSLFTCEPITVPRCMEMAYNMTFFPNLLGHYDQSIAAVEMKH
FLPLAKLKCSPNVETFLCKAFVPTCTEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEE
LECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFKSNELEFAKSFIGIVSIFCLCATLFTFLTFLIDVKRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTILFMLLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVALLGCYIYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSVREM
RGDGASTPRLREQDCGEPASPAASSSRLSGEQVERKGQAGSVSEGARSEGRISPKSDITD
TDRAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRREQGGGCHSDT
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggaaatgtttacattttggttgacgtgtatttttctacccctcgtaagagggcacagt
ctcttcacctgtgaaccaattactgttcccaggtgtatggaaatggcctacaacatgaca
tttttccctaatctcctgggtcattatgaccagagtattgccgcggtggaaatgaagcat
tttcttccccttgcaaaactgaaatgttcaccaaatgttgaaactttcctctgcaaagca
tttgtaccaacctgcacagagcaaattcatgtggttccaccttgtcgtaaactttgtgag
aaggtatattctgattgcaaaaaattaattgacacttttggaatccgatggcctgaggag
cttgaatgtgacagattacagtactgtgatgagactgttcctgtaacttttgatccacac
acagaatttcttggtcctcagaagaaaacagaacaagtccaaagagacattggattttgg
tgtccaaggcatcttaagacttctgggggacaaggatataagtttctgggaattgaccaa
tgtgcacctccgtgccccaacatgtattttaaaagtaatgagctagagtttgcaaaaagt
tttattggaatagtttcaatattttgtctttgtgcaactctgttcacattccttactttt
ttaattgatgttaaaagattcagatacccagagagaccaattatatattattctgtctgt
tacagcattgtatctcttatgtacttcattggatttttgctaggtgatagcacagcctgc
aataaggcagatgagaagctagaacttggtgacactgttgtcctaggctctcaaaataag
gcttgcaccattttgttcatgcttttgtatttttttacaatggctggcactgtgtggtgg
gtgattcttaccattacttggttcttagctgcaggaagaaaatggagttgtgaagccatc
gaacaaaaagcagtgtggtttcatgctgttgcatggggaacaccaggtttcctgactgtt
atgcttcttgctatgaacaaagttgaaggagacaacattagtggagtttgctttgttggc
ctttatgacctggatgcttctcgctactttgtactcttgccactgtgcctttgtgtgttt
gttgggctctctcttcttttagcgggcattatttctttaaatcatgttcgacaagttata
caacatgatggccggaaccaagaaaaactaaagaaatttatgattcgaattggagtcttc
agtggcttgtatcttgtgccattagtggcacttctcggatgttacatctatgagcaagtg
aacaggattacctgggagataacttgggtctctgatcattgtcgtcagtaccacatccca
tgtccttatcaggcaaaagcaaaagctcgaccagaattggctttatttatgataaaatac
ctgatgacattaattgttggcatctccgctgtcttctgggttggaagcaaaaagacatgc
acagaatgggctgggttttttaaacgaaatcgcaagagagatccaatcagtgaaagtcga
agagtactacaggagtcatgtgagtttttcttaaagcacaattctaaagttaaacacaaa
aagaagcactataaaccaagttcacacaagctgaaggtcatttccaaatccatgggaacc
agcacaggagctacagcaaatcatggcacttctgcagtagcaattactagccatgattac
ctaggacaagaaactttgacagaaatccaaacctcaccagaaacgtcagtgagagagatg
agaggagatggagcaagcacccccaggttaagagaacaggactgtggtgaacctgcctcc
ccagcagcatccagctccagactctctggggaacaggtcgaacggaagggccaggcaggc
agtgtatctgaaggtgcacggagtgaaggaaggattagtccaaagagtgatattactgac
actgaccgggcgcagagcaacaatttgcaggtccctagttcttcagaaccaagcagcctc
aaaggttccacatctctgcttgttcacccagtttcaggagtgagaagagagcagggaggt
ggttgtcattcagatacttga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396334
Entry
100396334         CDS       T03264                                 

Gene name
FZD3
Definition
(RefSeq) frizzled class receptor 3
  KO
K02329  frizzled 3
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04360  Axon guidance
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100396334 (FZD3)
   04390 Hippo signaling pathway
    100396334 (FZD3)
   04150 mTOR signaling pathway
    100396334 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100396334 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100396334 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    100396334 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100396334 (FZD3)
   05206 MicroRNAs in cancer
    100396334 (FZD3)
   05205 Proteoglycans in cancer
    100396334 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100396334 (FZD3)
   05226 Gastric cancer
    100396334 (FZD3)
   05217 Basal cell carcinoma
    100396334 (FZD3)
   05224 Breast cancer
    100396334 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100396334 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    100396334 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100396334 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100396334 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100396334 (FZD3)
G protein-coupled receptors [BR:cjc04030]
 Frizzled / Smoothened family
  100396334 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100396334
NCBI-ProteinID: XP_002756847
Ensembl: ENSCJAG00000015561
UniProt: U3CNR2
LinkDB
Position
13
AA seq 666 aa
MAVSWIVFCFWPLTMLMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGTPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGISLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSHPDLILF
LMKYLMALIVGIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctgtgagttggatcgtcttctgtttttggcccttgactatgctcatggggcatata
ggtgggcacagtttattttcttgtgaacctattaccttgaggatgtgccaagatttgcct
tataatactaccttcatgcctaatcttctgaatcattatgaccaacagacagcagcttta
gcaatggagccattccaccctatggtgaatctggattgttctcgggatttccggcctttt
ctttgtgctctgtatgctcctatttgtatggaatatggacgtgtcacacttccctgtcgt
aggctgtgtcagagggcttacagtgagtgctcgaagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgacgagccatatcctcgactt
gtagatctgaatttagctggagaaccaactgaaggaaccccagtggcagtgcagagagac
tatggtttttggtgtccccgagagttaaaaattgatcctgatctgggttattcttttctg
cacgtgcgtgattgttcacctccttgtccaaatatgtactttaggagagaagaactgtca
tttgctcgctatttcataggactgatttcaatcatttgcctctctgccacgttgtttact
tttttaacttttttgattgatgtcacaagattccgttaccctgaaaggcctattatattt
tatgcagtctgctacatgatggtatcattaattttcttcattggatttttgctagaggat
cgagtagcctgcaatgcatccatccctgcacaatataaggcttccacagtgacacaagga
tctcataataaagcctgtaccatgctttttatggtactctatttttttactatggctggc
agtgtatggtgggtaattcttaccatcacatggtttttagcagctgtgccaaagtggggt
agtgaagctattgagaagaaagcattgctgtttcatgccagtgcatggggcatccccgga
actctaactatcatccttttagcgatgaataaaattgaaggtgacaatatcagtggcgtg
tgttttgttggcctctatgatgttgatgcattgagatattttgttcttgctcccctctgc
ctgtatgtggtagttgggatttctctactcttagctggtattatatccctaaatagagtt
cgaattgagattccattagaaaaggagaaccaagataaattagtgaagtttatgatccgg
attggcgttttcagcattctttatctcgtaccactcttggttgtaattggatgctacttt
tatgagcaagcttaccgtggcatctgggaaacaacgtggatacaagaacgctgcagagaa
tatcacattccatgtccgtatcaggttactcaaatgagtcacccagacttgattctcttt
ctgatgaaatacctgatggctctcatagttggcattccctctgtattttgggttggaagc
aaaaagacatgctttgaatgggccagtttttttcatggtcgtagaaaaaaagagatagtg
aatgagagccggcaagtactccaggaacctgattttgctcagtctctcctgagagatcca
aatactcctatcataagaaagtcgaggggaacttccactcaaggaacatctacccatgct
tcttcaactcagctggctatggtggatgatcaaagaagcaaagcggggagcatccacagc
aaagtaagcagctaccacggcagcctccacagatcacgtgatggcaggtacacgccctgc
agttacagaggaatggaggagagactacctcatggcagcatgtcacgactgacagatcac
tccaggcatagtagttctcatcggctcaatgaacagtcacgacatagcagcatcagagat
ctcagtaataatcccatgactcacatcacacatggcaccagcatgaatcgggttattgaa
gaggatggaaccagtgcttaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398598
Entry
100398598         CDS       T03264                                 

Gene name
FZD8
Definition
(RefSeq) frizzled class receptor 8
  KO
K02375  frizzled 5/8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100398598 (FZD8)
   04390 Hippo signaling pathway
    100398598 (FZD8)
   04150 mTOR signaling pathway
    100398598 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100398598 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100398598 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100398598 (FZD8)
   05205 Proteoglycans in cancer
    100398598 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100398598 (FZD8)
   05226 Gastric cancer
    100398598 (FZD8)
   05217 Basal cell carcinoma
    100398598 (FZD8)
   05224 Breast cancer
    100398598 (FZD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100398598 (FZD8)
   05022 Pathways of neurodegeneration - multiple diseases
    100398598 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100398598 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100398598 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100398598 (FZD8)
G protein-coupled receptors [BR:cjc04030]
 Frizzled / Smoothened family
  100398598 (FZD8)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100398598
NCBI-ProteinID: XP_017829678
LinkDB
Position
7
AA seq 689 aa
MEWGYLLEVASLLAALALLQRSSGAAAASAKELTCQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCERLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGS
GYGRPPGGRPPHRGGGRGGGGGDAAAPPARGGGGRVRPPGGGAAPCEPGCQCRAPMVSVS
SERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFPTVSTFLID
MERFKYPERPIIFLSACYLFLSVGYLVRLVAGHDKVACIGGAPGAGGAGGACGGAAGAGA
ASAGAGGPGGRGEYEELGAVEHHVRYKTTGPALCSVVFLLVYFLVMASSIWWVILSLTWF
LEAGMKWGNETIAGYSQYFHLATWLVPNIXSIAVLALNSVDGDPVAGICYLVNHSLYNLR
GLVLAPLVIYLFIXTMFMLALLSSRSSVSASVIKQHDGPSKYSSIWDKLMILKGLKQVIY
TNKKEEVVEYIFIEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITS
GVWVWSGKTLESWRSLCTRCCWASKGAAGGGGAGATAAGGGGGPGGGGGGGPGGGGGGSL
YSDVSTGLTWRSGTASSVSYPKQMPLSQV
NT seq 2070 nt   +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtagcctcgctgctggccgccttggcgctgctgcag
cgctctagcggcgctgcggccgcctcggccaaggagctgacgtgccaagagatcaccgtg
ccgctgtgcaagggcatcggctacaactacacctacatgcccaaccagttcaaccacgac
acgcaggacgaggcgggcctggaggtgcaccagttctggccgctggtggagatccagtgc
tcgcccgacctcaagttcttcctgtgcagcatgtacacgcccatctgcctggaggactac
aagaagccgctgccgccctgccgctcggtgtgcgagcgcgccaaggccggctgcgcgccg
ctcatgcgccagtacggcttcgcctggcccgaccgcatgcgctgcgagcggctgcccgag
cagggcaaccccgacacgctgtgcatggactacaaccgcaccgacctcaccacggccgcg
cccagcccgccgcgccgcctgccgccgccgccgcccggcgagcagccgccctcgggcagc
ggctacggccgcccgccggggggcaggcccccgcaccgcggcggcggcaggggcggtggc
ggcggggacgctgcggcgcccccagctcgcggcggcggcgggagggtgcggccccctggc
ggcggcgcggctccctgcgagcccgggtgccagtgccgcgcgcccatggtgagcgtgtcc
agcgagcgccacccgctctacaaccgcgtcaagacaggccagatcgccaactgcgcgctg
ccgtgccacaacccctttttcagccaggacgagcgcgccttcaccgtcttctggatcggt
ctgtggtcggtgctctgcttcgtgtccaccttccccaccgtctccaccttcctcatcgac
atggagcgcttcaagtacccggagcggcccatcatcttcctctcggcctgctacctcttc
ctttcggtgggctacctggtgcgcctggtggcgggccacgataaggtggcgtgcatcggt
ggcgcgccaggcgcggggggcgcgggcggcgcatgcggcggggcggcgggagcgggcgcg
gcgagcgcgggcgccggcggcccgggcgggcgcggcgagtacgaagagctgggcgctgtg
gagcatcatgtgcgttacaaaaccacgggccctgcgctatgctcggtggtcttcctgctg
gtctacttcttagtcatggccagctctatctggtgggtgatcctgtcactcacgtggttc
ctggaggccggcatgaagtggggcaacgaaaccatcgccggctactctcaatacttccac
ctggccacgtggctcgtgcccaacatcnaatctatcgcggtgctggcgctcaactcggtg
gatggcgacccggtggcgggcatctgctacttggttaatcatagcctgtacaacctgcgc
ggtttagtgttggcgccgctggtcatctacctcttcatctgaacaatgttcatgctggcc
ctgctttcgagtcgctcttccgtatccgcttctgtcatcaagcaacatgatggaccctct
aaatactcatcaatatgggataaactgatgatcttaaagggcctgaaacaagttatttac
accaataaaaaagaagaggtggtggaatacatatttattgagcagcacaaccgcccgcgc
tgggaggccacgcacaactgcccgtgcctgcgggacctgcagcccgaccaggcgcgcagg
cctgattacgccgtcttcatgctcaaatacttcatgtgcctggtggtgggcatcacctcg
ggcgtatgggtctggtccggcaagacgttggagtcctggcgctcgctgtgcacccgctgc
tgctgggccagcaagggcgccgcggggggcgggggcgcgggcgccacagccgcggggggc
ggcggcgggccggggggcggcggcggcggaggtcccggcggcggcggcgggggctccctc
tacagcgacgtcagcactggcctgacgtggcggtctggcaccgccagctccgtgtcttat
ccaaagcagatgccattgtcccaggtctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398976
Entry
100398976         CDS       T03264                                 

Gene name
FZD10
Definition
(RefSeq) frizzled class receptor 10
  KO
K02842  frizzled 9/10
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100398976 (FZD10)
   04390 Hippo signaling pathway
    100398976 (FZD10)
   04150 mTOR signaling pathway
    100398976 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100398976 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100398976 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100398976 (FZD10)
   05205 Proteoglycans in cancer
    100398976 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100398976 (FZD10)
   05226 Gastric cancer
    100398976 (FZD10)
   05217 Basal cell carcinoma
    100398976 (FZD10)
   05224 Breast cancer
    100398976 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100398976 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    100398976 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100398976 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100398976 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100398976 (FZD10)
   04090 CD molecules [BR:cjc04090]
    100398976 (FZD10)
G protein-coupled receptors [BR:cjc04030]
 Frizzled / Smoothened family
  100398976 (FZD10)
CD molecules [BR:cjc04090]
 Proteins
  100398976 (FZD10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100398976
NCBI-ProteinID: XP_002753203
Ensembl: ENSCJAG00000022807
LinkDB
Position
9
AA seq 581 aa
MQRPGPQLWLVLQVLGACAAISSMDMERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPARGPGLFPPLFRPQRPHGAQEH
PLKDGTPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAVWTVLCFF
SSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHK
CKMNNQTKTPDCLMAASIPAVEIFMVKIFMLLVVGITSGVWIWTSKTLQSWQQVCSRRLK
KKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQPPTCV
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgcagcgcccgggcccgcagctgtggctggtcctgcaggtgctgggtgcgtgcgccgcc
atcagctccatggacatggagcgcccgggcgacggcaagtgccagccggtcgagatcccc
atgtgcaaggacatcggctacaacacgacccgcatgcccaacctgatgggccacgagaac
cagcgcgaggcggccatccagctgcacgagttcgcgccgctggtggagtacggctgccac
agccacctccgcttcttcctgtgctcgctgtacgcgcccatgtgcaccgagcaggtctcc
acgcccatcccagcctgccgggtcatgtgcgagcaggcccggctcaagtgctccccgatc
atggagcagttcaacttcaagtggccagactcgctggactgccggaagctccccaacaag
aacgaccccaactacctgtgcatggaggcgcccaacaacggctcggacgagcccgcccgc
ggcccgggcctgttcccgccgctgttccggccgcagcggccccacggcgcgcaggagcac
ccgctgaaggacgggacgcccgggcgcggcggctgcgacaacccgggcaagttccaccac
gtggagaagagcgcgtcgtgtgcgccgctctgcacgcccggcgtggacgtgtactggagc
cgcgaggacaagcgcttcgccgtggtctggctggccgtctggaccgtgctgtgcttcttc
tccagcgccttcaccgtgctcaccttcctcatcgacccggcgcgcttccgatacccggag
cgccccatcatcttcctctccatgtgctactgcgtctactccgtgggttacctcatccgc
ctgttcgccggcgccgagagcatcgcctgcgaccgcgacagcggccagctctatgtcatc
caggaggggctggagagcaccggctgcacgctggtcttcctggtgctctactactttggc
atggccagctcgctgtggtgggtggtcctcacgctcacctggttcctggccgccggcaag
aagtggggccacgaggccattgaggccaacagcagctatttccacctggcagcctgggcc
atcccggcggtgaagaccatcctcatcctggtcatgcgcagggtggcgggggacgagctc
accggggtctgctacgtgggcagcatggacgtcaacgcgctcacgggcttcgtgctggtc
cccctggcctgctacctggtcatcggcacgtccttcatcctctcgggcttcgtggccctg
ttccacatccggagggtgatgaagacgggcggcgagaacaccgacaagctggagaagctc
atggtgcgcatcgggctcttctccgtgctgtacaccgtgccggccacctgtgtgatcgcc
tgctacttctacgaacgcctcaacatggattactggaagatcctggcggcacagcacaag
tgcaaaatgaacaaccagacgaaaacgccggactgcctgatggccgcctccatccccgcc
gtggagatcttcatggtgaagatcttcatgctgctggtggtgggcatcaccagcggggtg
tggatttggacctccaagacgctgcagtcctggcagcaggtgtgcagccgcaggttaaag
aagaagagccggagaaaaccggccagcgtgatcaccagcggtgggatttacaaaaaagct
cagcatcctcagaaaactcaccacgggaaatacgagatccccgcccagccgcccacctgc
gtgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401631
Entry
100401631         CDS       T03264                                 

Gene name
FZD7
Definition
(RefSeq) frizzled class receptor 7
  KO
K02432  frizzled 1/7
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100401631 (FZD7)
   04390 Hippo signaling pathway
    100401631 (FZD7)
   04150 mTOR signaling pathway
    100401631 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100401631 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100401631 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100401631 (FZD7)
   05205 Proteoglycans in cancer
    100401631 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100401631 (FZD7)
   05226 Gastric cancer
    100401631 (FZD7)
   05217 Basal cell carcinoma
    100401631 (FZD7)
   05224 Breast cancer
    100401631 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100401631 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    100401631 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100401631 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100401631 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100401631 (FZD7)
G protein-coupled receptors [BR:cjc04030]
 Frizzled / Smoothened family
  100401631 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 100401631
NCBI-ProteinID: XP_008997472
Ensembl: ENSCJAG00000004918
UniProt: F7I3D1
LinkDB
Position
6
AA seq 574 aa
MRGPGAAASRSPLGLCALVLTLLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYLPDLPYTALPPGAADGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgcggggccccggcgcagccgcctcgcgctctcccctgggcctttgcgccctggtgctg
acgctgctgggcgcgctgtccgcgggcgccggggcgcagccgtaccacggagagaagggc
atctccgtgccggaccacggcttctgccagcccatctccatcccgctgtgcacggacatc
gcctacaaccagaccatcctgcccaacttgctgggccacacgaaccaagaggacgcgggc
ctcgaggtgcaccagttctacccgctagtgaaagtgcagtgctctcccgaactgcgcttc
ttcctgtgctccatgtacgcgcccgtgtgcaccgtgctcgatcaggctatcccgccgtgc
cgttccctgtgcgagcgcgcccgccagggctgcgaggcgctcatgaacaagttcggcttc
cagtggcccgagcggctgcgctgcgagaacttcccagtgcacggcgcgggcgagatctgc
gtgggccagaacacgtcggatggctccgggggcccaggcggcggccccactgcctaccct
actgcaccatacctgccggacctgccctataccgcgctgcccccgggggccgcagatggc
agggggcgtcccgccttccccttctcatgcccccgccagctcaaagtgcccccctacctg
ggctaccgcttcctgggtgagcgcgactgcggcgccccgtgcgaacccggccgtgccaac
ggcctgatgtactttaaggaggaggaaaggcgcttcgcccgcctctgggtgggcgtgtgg
tcggtgctgtgctgcgcctcgacgctctttactgttctcacctacctggtggacatgcgg
cgcttcagctacccagagcggcccatcatcttcctgtcgggctgctacttcatggtagcc
gtggcgcacgtggccggcttccttctggaggaccgcgccgtgtgcgtggagcgcttctcg
gatgatggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatcctcttc
atggtgctctacttctttggcatggccagctccatctggtgggtcattctgtcgctcact
tggttcctggcggccggcatgaaatggggccacgaggctatcgaggccaactcgcagtac
ttccacctggccgcgtgggctgtgcccgcagtcaagaccatcactatcctggccatgggc
caggtggatggggacctgctcagcggggtgtgctacgttggcctgtccagtgtggacgcg
ctgcgaggctttgtgctggcgcctctgttcgtctacctcttcatcggcacgtccttcctg
ctggcgggcttcgtgtctctcttccgtatccgcaccattatgaaacacgacggcaccaag
acggagaagctggagaagctcatggtgcgcatcggagtcttcagcgtgctctacactgtg
cccgccaccatcgtgctggcctgctacttctacgagcaggccttccgcgagcactgggag
cgcacctggctcctgcagacatgcaagagctacgctgtgccctgcccgcccggccatttc
ccacccatgagccccgacttcaccgtctttatgatcaagtacctgatgaccatgatcgtg
ggcatcaccactggcttctggatctggtcgggcaagactctgcagtcgtggcgccgcttc
taccacagactcagccacagcagcaagggggagactgcggtatga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403228
Entry
100403228         CDS       T03264                                 

Gene name
FZD4
Definition
(RefSeq) frizzled class receptor 4
  KO
K02354  frizzled 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100403228 (FZD4)
   04390 Hippo signaling pathway
    100403228 (FZD4)
   04150 mTOR signaling pathway
    100403228 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100403228 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100403228 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100403228 (FZD4)
   05205 Proteoglycans in cancer
    100403228 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100403228 (FZD4)
   05226 Gastric cancer
    100403228 (FZD4)
   05217 Basal cell carcinoma
    100403228 (FZD4)
   05224 Breast cancer
    100403228 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100403228 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    100403228 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100403228 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100403228 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100403228 (FZD4)
   04090 CD molecules [BR:cjc04090]
    100403228 (FZD4)
G protein-coupled receptors [BR:cjc04030]
 Frizzled / Smoothened family
  100403228 (FZD4)
CD molecules [BR:cjc04090]
 Proteins
  100403228 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 100403228
NCBI-ProteinID: XP_002754757
Ensembl: ENSCJAG00000000657
UniProt: F6W3M0
LinkDB
Position
11
AA seq 537 aa
MAWRGAGPSVPGTPGGVGLNLGWLLQLLLLVGPARGFGDEEERRCDPIRISMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGM
CLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
CHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRPAKEFTDIWMAVWASLCFISTAFTVLT
FLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLK
IFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggcctggcggggcgcagggccgagcgtcccggggacccccgggggcgtcgggctcaat
ctggggtggctgctgcagttgctgctgctggtggggccggcgcggggcttcggagacgag
gaggaacggcgctgcgaccccatccgcatctccatgtgccagaacctcggctacaacgtg
accaagatgcccaacctggtggggcacgagctgcagacggacgccgagctgcagctgaca
actttcacaccgcttatccagtacggctgctccagccagctgcagttcttcctttgttct
gtttatgtaccaatgtgcacagagaagatcaacatccccattggcccatgtggtggcatg
tgtctttcagtcaagaggcgctgtgaacccgtcttgaaggaatttggatttgcctggcca
gagagtctgaactgcagcaaattcccaccacagaatgaccacaaccacatgtgcatggaa
gggccaggtgatgaagaggtgcccttacctcacaaaacccccatccagcctggggaagag
tgtcactctgtgggaaccaattctgatcagtacatctgggtgaaaagaagcctgaactgt
gttctcaagtgtggctatgatgctggcttatacagccgcccggccaaggagttcaccgat
atctggatggctgtgtgggccagcctgtgcttcatctccactgccttcacagtactgacc
ttcctgatcgattcttctaggttttcctaccctgagcgccccatcatatttctcagtatg
tgctataatatttatagcattgcttatattgtcaggctgactgtaggccgggaaaggata
tcctgtgattttgaagaggcagcagaacccgttctcatccaagaaggacttaagaacaca
ggatgtgcaataattttcttgctgatgtacttttttggaatggccagctccatttggtgg
gttattctgacactcacttggtttttggcagcaggactcaaatggggtcatgaagccatt
gaaatgcacagctcttatttccacattgcggcctgggccatccccgcagtgaaaaccatt
gttatcttgattatgagactggtggatgcagatgaactgactggcctgtgctatgttgga
aaccaaaatctcgatgccctcaccgggttcgtggtggctcccctctttacttatttggtg
attggaactttgttcattgctgcaggtttggtggctttgttcaaaattcggtcaaatctc
caaaaggatgggacaaagacagacaaattagaaagactgatggtcaagattggggtcttc
tcagtcctgtacacagttcctgcaacgtgtgtgattgcctgttatttttatgaaatctcc
aattgggcactctttcggtattctgcagatgattccaacatggctgttgaaatgttaaaa
atttttatgtctttgctggtgggcatcacttcaggcatgtggatttggtctgccaaaact
cttcacacgtggcagaagtgttccaacagattggtgaattctggcaaggtaaagagagag
aagagaggaaatggttgggtgaagcctgggaaaggcaatgagactgtggtataa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403975
Entry
100403975         CDS       T03264                                 

Gene name
FZD9
Definition
(RefSeq) frizzled class receptor 9
  KO
K02842  frizzled 9/10
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100403975 (FZD9)
   04390 Hippo signaling pathway
    100403975 (FZD9)
   04150 mTOR signaling pathway
    100403975 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100403975 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100403975 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100403975 (FZD9)
   05205 Proteoglycans in cancer
    100403975 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100403975 (FZD9)
   05226 Gastric cancer
    100403975 (FZD9)
   05217 Basal cell carcinoma
    100403975 (FZD9)
   05224 Breast cancer
    100403975 (FZD9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100403975 (FZD9)
   05022 Pathways of neurodegeneration - multiple diseases
    100403975 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100403975 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100403975 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100403975 (FZD9)
   04090 CD molecules [BR:cjc04090]
    100403975 (FZD9)
G protein-coupled receptors [BR:cjc04030]
 Frizzled / Smoothened family
  100403975 (FZD9)
CD molecules [BR:cjc04090]
 Proteins
  100403975 (FZD9)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 100403975
NCBI-ProteinID: XP_008979860
LinkDB
Position
2
AA seq 591 aa
MAVAPMRGALLLWQLLAAGGAALEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNL
LGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARL
RCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRPA
RPPGDPGPGAGGGGTCKNPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALIWMAVWSA
LCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGA
LYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHM
AAWGLPALKTIVILTLRKVAGDELTGLCYVASSDAAALTGFVLVPLSCYLVLGSSFLLTG
FVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRA
TEQSCAAAAGPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSL
CHRKMAAGRARAKACRTPGGYGRGMHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggccgtggcgccgatgcggggggcgctgctgctgtggcagctgctggcggcgggcggc
gcggcgctggagatcggccgcttcgacccggagcgcgggcgcggggcggcgccgtgccag
gcggtggagatccccatgtgccgcggcatcggctacaacctgacccgcatgcccaacctg
ctgggccacacgtcgcagggcgaggcggccgccgagctggcggagttcgcgcccctggtg
cagtacggctgccacagccacctgcgcttcttcctgtgctcgctctacgcgcccatgtgc
accgaccaggtctcgacgcccatccccgcctgccggcccatgtgcgagcaggcgcgcctg
cgctgcgcgcccatcatggagcagttcaactttggctggccggactcgctcgactgcgcc
cggctgcccacgcgcaacgacccgcacgcgctgtgcatggaggcgccggagaacgccacg
gccggccccacggagccccacaagggcctgggcatgctgcccgtggcgccgcggcccgcg
cgccctcccggagacccgggcccgggtgcgggcggcggcggcacctgcaagaacccggag
aagttccagtacgtggagaagagtcgctcgtgcgcgccgcgctgcgggcccggcgtcgag
gtgttctggtcccggcgcgacaaggacttcgcgctgatctggatggcggtgtggtcggca
ctgtgcttcttctccaccgccttcaccgtgctcaccttcctgctggagccccaccgcttc
caatacccggagcgccccatcatcttcctatccatgtgctacaacgtctactctctggcc
ttcctgatccgcgcggtggccggggcgcagagcgtggcctgtgaccaggaggcgggcgca
ctctacgtgatccaggagggcctggagaacacgggctgcacgctggtcttcctgctgctc
tactacttcggcatggccagctcgctctggtgggtggtcctgacgctcacctggttcctg
gcggctgggaagaaatggggccacgaggccatcgaggcccacggcagctacttccacatg
gctgcctggggcctgcccgcgctgaagaccatcgtcatcctgaccctacgcaaggtggcc
ggggatgagctgaccgggctctgctacgtggccagctcggacgcagcagcgctcacgggc
ttcgtgctggtgcctctctcctgctacctggtgctgggcagtagcttcctcctgaccggc
ttcgtggccctcttccacatccgcaagatcatgaagacgggcggcaccaacacagagaag
ctggagaagctcatggtcaagattggggtcttctccatcctctacacggtgcctgccact
tgcgtcattgtttgctacgtctacgaacgcctcaacatggacttctggcgtcttcgggcc
acggagcagtcatgcgcagcggcggccgggcctggaggccggagggactgctcgctgccg
gggggctcggtgcccaccgtggccgtcttcatgctcaaaatcttcatgtcgctggtggtg
ggcatcaccagcggcgtctgggtgtggagctccaagactttccagacctggcagagcctg
tgccaccgcaagatggcagctggccgcgcccgggccaaggcctgccggacccccgggggc
tatggccgtggcatgcactgccactataaggctcccaccgtggtcttgcacatgactaag
acggacccctctctggagaaccccacacacctctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404550
Entry
100404550         CDS       T03264                                 

Gene name
FZD1, FZD7, frizzled-1
Definition
(RefSeq) frizzled class receptor 1
  KO
K02432  frizzled 1/7
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100404550 (FZD1)
   04390 Hippo signaling pathway
    100404550 (FZD1)
   04150 mTOR signaling pathway
    100404550 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100404550 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100404550 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100404550 (FZD1)
   05205 Proteoglycans in cancer
    100404550 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100404550 (FZD1)
   05226 Gastric cancer
    100404550 (FZD1)
   05217 Basal cell carcinoma
    100404550 (FZD1)
   05224 Breast cancer
    100404550 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100404550 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    100404550 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100404550 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100404550 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100404550 (FZD1)
G protein-coupled receptors [BR:cjc04030]
 Frizzled / Smoothened family
  100404550 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 100404550
NCBI-ProteinID: XP_017830849
LinkDB
Position
8
AA seq 581 aa
MRGPGAAASRSPLGLCALVLTLLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYLPDLPYTALPPGAADGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDFTVFMIK
YLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgcggggccccggcgcagccgcctcgcgctctcccctgggcctttgcgccctggtgctg
acgctgctgggcgcgctgtccgcgggcgccggggcgcagccgtaccacggagagaagggc
atctccgtgccggaccacggcttctgccagcccatttccatcccgctgtgcacggacatc
gcgtacaaccagaccatcatgcccaatctgctgggccacacgaaccaggaggacgcgggc
ctcgaggtgcaccagttctacccgctagtgaaagtgcagtgctctcccgaactgcgcttc
ttcctgtgctccatgtacgcgcccgtgtgcaccgtgctcgatcaggctatcccgccgtgc
cgttccctgtgcgagcgcgcccgccagggctgcgaggcgctcatgaacaagttcggcttc
cagtggcccgagcggctgcgctgcgagaacttcccagtgcacggcgcgggcgagatctgc
gtgggccagaacacgtcggatggctccgggggcccaggcggcggccccactgcctaccct
actgcaccatacctgccggacctgccctataccgcgctgcccccgggggccgcagatggc
agggggcgtcccgccttccccttctcatgcccccgccagctcaaagtgcccccctacctg
ggctaccgcttcctgggtgagcgcgactgcggcgccccgtgcgaacccggccgtgccaac
ggcctgatgtactttaaggaggaggaaaggcgcttcgcccgcctctgggtgggcgtgtgg
tcggtgctgtgctgcgcctcgacgctctttactgttctcacctacctggtggacatgcgg
cgcttcagctacccagagcggcccatcatcttcctgtcgggctgctacttcatggtagcc
gtggcgcacgtggccggcttccttctggaggaccgcgccgtgtgcgtggagcgcttctcg
gatgatggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatcctcttc
atgatgctctacttcttcagcatggccagctccatctggtgggtgatcctgtcgctcacc
tggttcctggcggctggcatgaagtggggccatgaggccattgaggccaactcacagtat
tttcacctagccgcctgggctgtgccggccatcaagaccatcaccatcctggcgctgggc
caggtggacggcgatgtgctgagcggagtgtgcttcgtggggctcaacaatgtggacgcg
ctgcgtggcttcgtgctggcgcccctcttcgtgtacctgttcatcggcacgtcctttctg
ctggccggttttgtgtcgctcttccgcatccgcaccatcatgaagcacgatggcaccaag
accgagaagctggagaagctcatggtgcgcattggcgtcttcagcgtgctgtacactgtg
ccagccaccattgtcatcgcctgttacttctacgagcaggccttccgggaccagtgggaa
cgcagctgggtggcccagagctgcaagagctacgctatcccctgccctcacctccaggcg
ggcggaggcgccccaccgcacccgcccatgagcccagacttcacggtcttcatgatcaag
taccttatgacgctgatcgtgggcatcacgtcgggcttctggatctggtcgggcaagacc
cttaactcctggaggaagttctacacgaggctcaccaacagcaaacagggggagactacc
gtctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100409481
Entry
100409481         CDS       T03264                                 

Gene name
FZD2
Definition
(RefSeq) frizzled class receptor 2
  KO
K02235  frizzled 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100409481 (FZD2)
   04390 Hippo signaling pathway
    100409481 (FZD2)
   04150 mTOR signaling pathway
    100409481 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100409481 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100409481 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100409481 (FZD2)
   05205 Proteoglycans in cancer
    100409481 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100409481 (FZD2)
   05226 Gastric cancer
    100409481 (FZD2)
   05217 Basal cell carcinoma
    100409481 (FZD2)
   05224 Breast cancer
    100409481 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100409481 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    100409481 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100409481 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100409481 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100409481 (FZD2)
G protein-coupled receptors [BR:cjc04030]
 Frizzled / Smoothened family
  100409481 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100409481
NCBI-ProteinID: XP_017827895
UniProt: A0A2R8MXI9
LinkDB
Position
5
AA seq 565 aa
MRPRSALPRLLLSLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNL
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQG
CEALMNKFGFQWPDRLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTP
GGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEE
TRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYISGFVL
QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKW
GHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACY
FYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIW
SGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcggccccgcagcgccctgccccgcctgctgctgtcgctgcttcttctgcccgccgcc
gggccggcccagttccacggggagaagggcatctccatcccggaccacggcttctgccag
cccatctccatcccgctgtgcaccgacatcgcctacaaccagaccatcatgcccaacctt
ctgggccacacgaaccaggaggacgcaggcctggaggtgcaccagttctatccactggtg
aaggtgcagtgctcccccgaactgcgcttcttcctgtgctccatgtacgcacccgtgtgc
accgtgctggaacaggccatcccgccgtgccgctctatctgcgagcgcgcgcgccagggc
tgcgaagcgctcatgaacaagttcggttttcagtggcccgatcgcctgcgctgcgaacac
ttcccgcgccacggcgcggagcagatctgcgtgggccagaaccactccgaggacggagcg
ccagcgctgctcactaccgcgccaccgccaggtctgcagcccggcgccgggggcaccccg
ggcggcccaggcggcggcggcgctcccccgcgctacgccacgctggagcacccgttccac
tgcccgcgcgtcctcaaggtgccatcctatctcagctacaagtttctgggcgagcgtgac
tgtgccgcgccctgcgaacccgcgcggccagatggttccatgttcttctcgcaagaggag
acgcgtttcgcgcgcctctggatcctcacctggtcggtgctgtgctgcgcctccaccttc
ttcactgtcaccacgtacctggtagacatgcagcgcttccgctacccagagcggccaatc
atttttctgtcgggctgctacaccatggtgtcggtggcctacatctcgggcttcgtgctc
caggagcgcgtggtgtgcaacgagcgcttctccgaggacggttaccgcacggtggtgcag
ggcaccaaaaaggagggctgcaccatcctcttcatgatgctttacttcttcagcatggcc
agctccatctggtgggtcatcctgtctctcacctggttcctggcagccggcatgaagtgg
ggccacgaggccatcgaggccaactctcagtacttccacctggccgcctgggccgtgcca
gcggtcaagactataaccatcttggccatgggccagatcgacggcgacctgctgagcggc
gtgtgcttcgtgggtctcaatagcctggacccgctgcggggcttcgtgctggcgccgctc
ttcgtgtacctgttcatcggcacgtcgttcctcctggccggcttcgtgtcgctcttccgc
atccgcaccatcatgaagcacgacggcaccaagaccgagaagctggagcggctcatggtg
cgcatcggcgtcttctcggtgctctacacggtgcccgccaccatcgtcatcgcctgctac
ttctacgagcaggccttccgcgagcactgggagcgctcgtgggtgagccaacactgcaag
agcctggccatcccgtgcccggcgcactacacgccgcgcatgtcgcccgacttcacggtc
tacatgatcaaatacctcatgacgctcatcgtgggcatcacatcgggcttctggatttgg
tcgggcaagacgctgcactcgtggaggaagttctacactcgcctcaccaacagtcggcac
ggcgagaccaccgtgtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410939
Entry
100410939         CDS       T03264                                 

Gene name
FZD5
Definition
(RefSeq) frizzled class receptor 5
  KO
K02375  frizzled 5/8
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04150  mTOR signaling pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04916  Melanogenesis
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100410939 (FZD5)
   04390 Hippo signaling pathway
    100410939 (FZD5)
   04150 mTOR signaling pathway
    100410939 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100410939 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100410939 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100410939 (FZD5)
   05205 Proteoglycans in cancer
    100410939 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100410939 (FZD5)
   05226 Gastric cancer
    100410939 (FZD5)
   05217 Basal cell carcinoma
    100410939 (FZD5)
   05224 Breast cancer
    100410939 (FZD5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100410939 (FZD5)
   05022 Pathways of neurodegeneration - multiple diseases
    100410939 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100410939 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100410939 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100410939 (FZD5)
G protein-coupled receptors [BR:cjc04030]
 Frizzled / Smoothened family
  100410939 (FZD5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100410939
NCBI-ProteinID: XP_002749755
Ensembl: ENSCJAG00000022490
LinkDB
Position
6
AA seq 585 aa
MARPDPSAPPSLLLLLLAQLAGRATAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRAFPAKPTLPGPPGAPASGG
ECPAGGPSVCKCRDPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSSDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HRAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPAPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
PRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAAAYHKQVSLSHV
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggctcggcctgacccgtccgcgccgccgtctctgctgctgctgctcctggcgcagctg
gcgggccgggcgaccgccgcatccaaggccccggtgtgccaagaaatcacggtgcccatg
tgccgcggcatcggctacaacctgacgcacatgcccaaccagttcaaccacgacacgcag
gacgaggcgggcctggaggtgcaccagttctggccgctggtggagatccactgttcgccg
gacctgcgcttcttcctgtgctccatgtacacgcccatctgcctgcccgactatcacaag
ccgctaccgccctgccgctcggtgtgcgagcgcgccaaggccggctgctcgccgctcatg
cgccagtacggcttcgcttggccggagcgcatgagctgcgaccgcctcccggtgctgggc
cgcgacgccgaggtcctgtgcatggattacaaccgcagcgaggccaccacggctcccccc
agggccttcccagccaagcccacacttccaggcccaccaggggcgccggcctcagggggc
gaatgccccgctgggggcccgtctgtgtgcaagtgtcgcgatcccttcgtgccgatcctg
aaggagtcacacccgctctacaacaaggtgcggacggggcaggtgcccaactgcgcggta
ccctgctaccagccgtccttcagttccgatgagcgcacgttcgccaccttctggatcggc
ctgtggtcggtgctgtgcttcatctccacgtccaccacagtggccacgttcctcatcgac
atggaacgcttccgctatcctgagcgccccatcatcttcctgtccgcctgttacctatgc
gtgtcgctgggcttcctagttcgcctggtcgtgggccatgccagcgtggcctgcagccgt
gagcacaaccacatccactacgagaccacgggccctgcgctgtgcaccattgtcttcctc
ctggtctacttcttcggcatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcctggcagccggcatgaagtggggcaatgaggccatcgcgggctacgcgcagtacttc
caccgggctgcgtggctcatccccagcgtcaaatccatcacggcgctggcgctgagctcc
gtggacggggacccggtggctggcatctgctacgtgggcaaccagaacctgaactcgctg
cgcggcttcgtgctgggcccgctggtgctctacctgttggtgggcacgctcttcctgctg
gcgggctttgtgtcgctcttccgcatccgtagcgtcatcaagcagggcggcaccaagacg
gacaagctggagaagctcatgatccgcatcggcatcttcacgctgctctacacggtgccc
gccagcatcgtggtggcctgctacctgtacgagcagcactatcgcgagagctgggaggcg
gcgctcacctgtgcctgcccggcccccgacgccggccagccgcgcgccaagcccgagtac
tgggtgctcatgctcaagtacttcatgtgcctggtggtgggcatcacgtcgggtgtctgg
atctggtcgggcaagacggtggagtcgtggcggcgtttcaccagccgctgctgctgccgc
ccgcggcgcggccacaagagcgggggcgccatggccgccggggactaccccgaggccagc
gcggcactcacgggcaggaccgggccgccgggccccgccgccgcctaccacaaacaggtg
tccctgtcgcacgtgtag

DBGET integrated database retrieval system