KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100387250
Entry
100387250         CDS       T03264                                 

Gene name
FHL1
Definition
(RefSeq) four and a half LIM domains 1
  KO
K14365  four and a half LIM domains protein 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100387250 (FHL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cjc04990]
    100387250 (FHL1)
Domain-containing proteins not elsewhere classified [BR:cjc04990]
 LIM domain-containing proteins
  FHL family proteins
   100387250 (FHL1)
SSDB
Motif
Pfam: LIM Ureidogly_lyase
Other DBs
NCBI-GeneID: 100387250
NCBI-ProteinID: XP_002763356
Ensembl: ENSCJAG00000003771
LinkDB
Position
X
AA seq 280 aa
MAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYKNRF
WHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPRCKGCFKAIVAGDQNVEYKGT
VWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVKCNKAITSGGITYQDQP
WHADCFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAY
EGQSWHDYCFHCKKCSVNLANKRFVFHEEQVYCPDCAKKL
NT seq 843 nt   +upstreamnt  +downstreamnt
atggcggagaagtttgactgccactactgcagggaccccttgcaggggaagaagtatgtg
cagaaggatggtcaccactgctgcctgaagtgctttgacaagttctgtgccaacacctgc
gtggagtgccgcaagcccatcggggcggactccaaggaggtgcactataagaaccgcttc
tggcacgacacctgcttccgctgtgccaagtgccttcaccccttggccaatgagaccttt
gtggccaaggacaacaagatcctgtgcaacaagtgcaccactcgggaggactcccccagg
tgcaaagggtgcttcaaggccattgtggcaggagatcaaaacgtggagtacaaggggacc
gtctggcacaaagactgcttcacctgcagtaactgcaagcaagtcatcgggactggaagc
ttcttccctaaaggggaggacttctactgcgtgacttgccatgagaccaagtttgccaag
cattgcgtgaagtgcaacaaggccatcacatctggaggaatcacttaccaggatcagccc
tggcatgccgattgctttgtgtgtgttacctgctctaagaagctggctgggcagcgtttc
accgctgtggaggaccagtattactgcgtggattgctacaagaactttgtggccaagaag
tgtgctggatgcaagaaccccatcactgggtttggtaaaggctccagtgtggtggcctat
gaaggacaatcctggcacgactactgcttccactgcaaaaaatgctccgtgaatctggcc
aacaagcgctttgttttccacgaggagcaagtgtattgtcccgactgtgccaaaaagctg
taa

DBGET integrated database retrieval system