KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388478Help
Entry
100388478         CDS       T03264                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00010  Glycolysis / Gluconeogenesis
cjc00053  Ascorbate and aldarate metabolism
cjc00071  Fatty acid degradation
cjc00280  Valine, leucine and isoleucine degradation
cjc00310  Lysine degradation
cjc00330  Arginine and proline metabolism
cjc00340  Histidine metabolism
cjc00380  Tryptophan metabolism
cjc00410  beta-Alanine metabolism
cjc00561  Glycerolipid metabolism
cjc00620  Pyruvate metabolism
cjc01100  Metabolic pathways
Module
cjc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100388478 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    100388478 (ALDH2)
   00620 Pyruvate metabolism
    100388478 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100388478 (ALDH2)
   00561 Glycerolipid metabolism
    100388478 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100388478 (ALDH2)
   00310 Lysine degradation
    100388478 (ALDH2)
   00330 Arginine and proline metabolism
    100388478 (ALDH2)
   00340 Histidine metabolism
    100388478 (ALDH2)
   00380 Tryptophan metabolism
    100388478 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100388478 (ALDH2)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100388478 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1235
Motif
Other DBs
NCBI-GeneID: 100388478
NCBI-ProteinID: XP_009002916
Ensembl: ENSCJAG00000011989
UniProt: F7ATY6
LinkDB All DBs
Position
9
AA seq 517 aa AA seqDB search
MLRAAARLGPRLGHRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSGKTFPTVNPS
TGEIICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTETGRLIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVDRSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINSGKQEGAKLLCGGGVAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTMEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgccgccgcccgcctcgggcctcgcctgggccaccgcctcttgtccgccgct
gccacccaggctgtgcccgcccccaaccagcagcccgaggtgttctgcaaccagatcttc
ataaacaatgaatggcatgatgctgtcagcgggaaaacattccccacggtcaatccgtcc
actggagagatcatctgtcaggtagctgaaggggacaaggaagatgtggacaaggcagtg
aaggctgcccgggctgccttccagctaggctcaccatggcgccgcatggatgcatcacac
aggggccggctgctgaatcgcctggctgatctgatcgagcgggaccgcacctacctggca
gccttggagaccctggacaatggcaagccctatgtcatctcctacctggtggatttggac
atggtcctcaaatgtctcaggtattatgccggatgggctgataagtaccacgggaaaacc
attcctattgatggagacttcttcagctacacccgccatgaacctgtgggggtgtgtggg
cagatcattccgtggaattttccacttctgatgcaagcgtggaagctgggcccagccttg
gcgactggaaacgtggttgtgatgaaggtagctgagcagacaccccttaccgccctctat
gtggccaacctgatcaaggaggccggctttccccctggtgtggttaacattgttcctgga
tttggccctactgctggggctgctattgcctcccatgaggatgtggacaaagtggcattc
acaggctccaccgagactggccgcctaatccaggtagctgccgggagtagcaacctcaag
agagtgaccctggagctaggggggaagagccccaatatcatcatgtcagatgccgacatg
gactgggcggtggagcaggcccactttgccctgttcttcaaccagggccagtgctgctgt
gccggctcccggaccttcgtgcaagaggatatctacgatgagtttgtggatcggagcgtt
gcccgggccaagtctcgggtggtcgggaacccctttgacagtaagaccgagcaggggcca
caggtggatgaaactcagttcaagaagatcctcggctacattaactctgggaaacaagaa
ggggcaaagctgctgtgtggtgggggcgttgctgccgaccgtggctactttatccagccc
actgtgtttggagatgtgcaggatggcatgaccatcgccaaggaggagatcttcgggcca
gtgatgcagattctgaagttcaagaccatggaggaagttgtcgggagagccaacaattcc
acgtacgggctggctgcggctgtcttcacaaaggacttggacaaggccaattacctgtcc
caggccctccaggcaggcaccgtgtgggtcaactgctatgatgtgtttggcgcccagtca
ccctttggcggctacaaaatgtcagggagtggccgggagctgggcgagtatggccttcag
gcatacaccgaagtgaaaactgtcacagtcaaagtgcctcagaagaactcctaa

DBGET integrated database retrieval system