KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100388523
Entry
100388523         CDS       T03264                                 

Gene name
ABL2
Definition
(RefSeq) ABL proto-oncogene 2, non-receptor tyrosine kinase
  KO
K08887  abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100388523 (ABL2)
   04014 Ras signaling pathway
    100388523 (ABL2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100388523 (ABL2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100388523 (ABL2)
Protein kinases [BR:cjc01001]
 Non-receptor tyrosine kinases
  ABL family
   100388523 (ABL2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 SH3_6
Other DBs
NCBI-GeneID: 100388523
NCBI-ProteinID: XP_017821529
Ensembl: ENSCJAG00000008288
UniProt: A0A2R8MAK2
LinkDB
Position
18
AA seq 1080 aa
MGQQVGRVGEAPGLQQPQPRGFRGSSAARPSSRRRDPAGRTTETGFNIFTQHDHFASCVE
DGFEGDKTGGSSPEALHRPYGCDLEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVA
SGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSR
SAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTADGKVYVTAESRFST
LAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYG
EVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIV
TEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGEN
HVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIAT
YGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFE
TMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQAENKENIEGAQDDAT
ENSASSLAPGFLRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKK
RNAPTPPKRSSSFREMENQPHKKYELTGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQP
EENVDRANDMLLKKSEEGAAPTRERPKAKLLPRGATALPLRTPSGDLAITEKDSPGMGVA
GVTAAPKGKEKNGGTRLGMVGVPEDGEQPGWSSPAKAAPVLPTTHNHKVPVLISPTLKHT
PADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHSSLCSDP
TEEPTAPAAGQSTSETQEGGKKAAPGAVPISGKAGRPVVPPPQVPLPTSSISPAKMANGT
AGTKVALRKTKQAAEKISADKISKEALLECADLLSSAITEPLPNSQLVDTGHQLLDYCSG
YVDCIPQTRNKFAFREAVSKLELSLQELQVSSAAAGVPGANPVLNNLLSCVQEISDVVQR
NT seq 3243 nt   +upstreamnt  +downstreamnt
atggggcagcaggtgggccgcgtcggggaggctcccgggctccagcagcctcagccccgc
gggttccggggcagcagtgctgccaggccctccagccgcaggcgggacccggcggggcgc
accacagagaccggcttcaatatcttcacccagcatgatcactttgccagctgtgtggag
gatggatttgagggagacaagactggaggcagtagtccagaagctttgcatcgtccctac
ggttgtgatcttgaaccccaggcactaaatgaggctatcaggtggagctccaaggagaac
ttgctgggagccactgagagtgaccccaatctttttgttgcactttatgattttgtagca
agtggtgataacacactcagcatcactaaaggtgaaaagctacgagtacttggttacaac
cagaatggcgagtggagtgaagttcgttctaagaatgggcagggctgggtgccaagcaac
tacatcaccccagtgaacagcctggaaaaacactcctggtaccatggacctgtgtcacgc
agtgcagctgagtatctgctcagcagtctaatcaatggcagcttcctggtgcgagaaagt
gagagtagccctgggcagctgtccatctcgctcaggtatgaggggcgtgtgtatcactac
aggatcaataccactgcagatggcaaggtatatgtgactgctgagagccgcttcagcacc
ttggcagagcttgtacaccatcactccacagtggctgatgggctggtgacaacattacac
tacccagcacccaagtgcaataagcctacagtctacggtgtgtcccccatccatgacaaa
tgggaaatggaacgaacagatattaccatgaagcacaaactggggggcggtcagtatgga
gaggtttacgttggcgtctggaagaaatacagccttacagttgctgtgaaaacattgaag
gaagataccatggaggtagaagagttcctaaaagaagctgcagtgatgaaggaaatcaag
catcctaatctggtacaacttttaggtgtgtgtactttggagccaccgttttacattgtg
actgaatacatgccatatgggaatttgctggattatctccgagagtgcaaccgagaagag
gtgactgcagttgtgctgctctacatggccactcagatttcttctgcaatggagtactta
gagaagaagaatttcatccatagagatcttgcagctcgtaactgcctagtgggagaaaac
catgtggtaaaagtggctgactttggtttaagtagattgatgactggagacacttacact
gctcatgctggagccaaatttcctattaagtggacagcaccagagagtcttgcctacaat
accttctcaattaaatctgatgtctgggcttttggggtactgttgtgggaaattgctacc
tatggaatgtcaccatatccaggtattgacctgtctcaggtctatgacctactagaaaaa
ggatatcgaatggaacagcctgagggatgccccccgaaagtttatgaacttatgagagca
tgctggaagtggagccctgccgataggccctcttttgctgaaacacaccaagcttttgaa
accatgttccatgactccagcatttctgaagaagtagctgaggagcttgggagagctgcc
tcctcgtcatctgttgttccatacctgccccggctacctatacttccttccaagactcgg
acactgaagaaacaggcagagaacaaggagaacattgaaggggcacaagatgatgccaca
gaaaactctgcttccagtttagcaccagggttcctcagaggtgcacaggcctccagtgga
tccccagcactgcctcgaaagcaaagagacaagtcacccagtagcctcttggaagatgcc
aaagagacatgcttcaccagggataggaaagggggcttcttcagctccttcatgaaaaag
agaaatgctcccacaccccccaaacgcagcagctccttccgagaaatggagaatcagccc
cataagaaatacgaactcacggggcttccagagcaggataggatggcaatgacccttccc
aggaactgccagaggtccaaactccagctggaaaggacagtgtccacctcttctcagcca
gaagagaatgtggacagggccaatgacatgcttctaaaaaaatcagaggaaggtgctgct
ccaaccagggagagaccaaaagccaagttactgcccagaggagccacagctcttcctctt
agaaccccctctggggatctagccattacagagaaggactctccagggatgggagtggct
ggagtgacagctgcccccaagggcaaagagaagaatggtgggacacgacttgggatggtt
ggagtcccagaggatggagagcagcccggctggtcttctccagccaaggctgcccctgtc
ctcccaaccactcacaaccacaaagtgccagtccttatctcacccactctgaaacacact
ccagctgatgtgcagcttattggcacagactctcaggggaataaattcaagctcttatct
gagcatcaggttacatcctctggagacaaggaccgaccccgacgggtaaaaccaaagtgt
gccccacccccaccaccagtgatgagactactgcagcattcatccttatgttcagaccct
acagaagagccgactgccccggctgcaggacagtccacatcagaaacacaggaaggagga
aagaaggcagctccgggcgcagtgcccatcagtgggaaagctgggaggccagtggtgcct
ccacctcaagtgcctctgcccacgtcttccatctcgcccgccaaaatggccaacggcaca
gcaggtactaaagtggccctgagaaaaaccaaacaggccgctgagaaaatctcagcagac
aaaatcagcaaagaggccctgctggaatgtgctgacctactgtccagtgcaatcacggaa
cctctgcccaacagccagctggtagacactggacaccagctgctcgactactgctcaggc
tacgtggactgcatccctcaaactcggaacaaatttgccttccgagaggctgtgagcaaa
ctggaactcagcttacaggagctacaggtgtcttcagcagctgctggtgtgcccggggca
aaccccgtccttaataacttattgtcatgtgtacaggaaatcagtgatgtagtacagagg
tag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100398414
Entry
100398414         CDS       T03264                                 

Gene name
ABL1
Definition
(RefSeq) ABL proto-oncogene 1, non-receptor tyrosine kinase
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04110  Cell cycle
cjc04360  Axon guidance
cjc04722  Neurotrophin signaling pathway
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05220  Chronic myeloid leukemia
cjc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100398414 (ABL1)
   04014 Ras signaling pathway
    100398414 (ABL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100398414 (ABL1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100398414 (ABL1)
  09158 Development and regeneration
   04360 Axon guidance
    100398414 (ABL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100398414 (ABL1)
   05206 MicroRNAs in cancer
    100398414 (ABL1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100398414 (ABL1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100398414 (ABL1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100398414 (ABL1)
Protein kinases [BR:cjc01001]
 Non-receptor tyrosine kinases
  ABL family
   100398414 (ABL1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 Kinase-like SH3_6
Other DBs
NCBI-GeneID: 100398414
NCBI-ProteinID: XP_002743448
Ensembl: ENSCJAG00000020525
UniProt: U3BH45
LinkDB
Position
1
AA seq 1149 aa
MGQQPGKVLGDQRRPSLPALHFIKGAGRKESSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGIRGAAST
LLQAPELPTKTRTSRRAAEHRDAADVPEVHHSKGQGESDPLDHELAVSPLLPRKERGPPE
GGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDI
SNGALALTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATG
EEDGGSSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPA
LPRKRAGENRPDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPSLTPKLLRRQ
AMMAPASGLPNKEEAGKGGALGTPAVAEPVPPTSKAGSGVPAGTSKGPTEESRVRRHKHS
SESPGRDKGKLSRLKPAPPPPPAASAGKAGGKPSQSPSQEAAGEAGLGAKTKATSLADAV
NSDAAKPSQLGEGFKKPVLPATPKPQSTKPSGTPVSPAPIPSTLPSASSALAGDQPSSTA
FIPLISTRVSLRKTRQPPERIASGTITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGK
NLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSV
KEISDIVQR
NT seq 3450 nt   +upstreamnt  +downstreamnt
atggggcagcagcctggaaaagttcttggggaccaaagaaggccaagtttgcctgccctg
cattttatcaaaggagcagggaggaaggagtcctcgaggcatgggggcccacactgtaat
gtttttgtggaacatgaagcccttcagaggccagtagcatcggactttgagcctcagggt
ctgagtgaagccgctcgttggaactccaaggaaaaccttctcgctggacccagtgaaaat
gaccccaacctttttgttgcactgtatgattttgtggccagtggagataacactctaagc
ataactaaaggtgaaaagctccgtgtcttaggctataatcacaatggggaatggtgtgaa
gcccaaaccaaaaatggccaaggctgggtgccaagcaactacatcacgccagtcaacagt
ctggagaagcactcctggtaccatggacctgtgtcccgcaatgccgctgaatatctgctg
agcagtgggatcaatggcagcttcttggtgcgggaaagtgagagcagtcctggccagagg
tccatctcactgagatacgaagggagggtgtaccattacaggatcaacactgcttctgat
ggcaagctctacgtctcctccgagagccgcttcaacaccctggccgagttggttcatcat
cactcaacagtggccgacgggctcatcaccacgctccattatccggcccccaagcgcaac
aagcccactgtctacggcgtgtcccccaactacgacaagtgggagatggagcgcaccgac
atcaccatgaagcacaagctgggcgggggccagtatggggaggtgtatgagggcgtgtgg
aagaagtacagtctgacagtggccgtgaagaccttgaaggaggacaccatggaggtggaa
gagttcttgaaagaagctgcagtcatgaaagagatcaaacaccctaacctggtccagctc
cttggggtctgtacccgggagcccccgttctatatcatcaccgagtttatgacctatggg
aacctgctggactacctgagggagtgcaaccggcaggaggtgaatgccgtggtgctgctg
tacatggccactcagatctcatcagccatggagtacctggagaagaagaacttcatccac
agagatcttgctgcccgaaactgcctggtaggggagaaccacttggtgaaggtggcagat
tttggcctgagcaggttgatgacaggggacacctacactgcccatgccggagccaaattc
ccaatcaaatggactgcacctgagagcctggcctacaacaagttctccatcaagtctgat
gtctgggcatttggagtattgctttgggaaattgctacctatggcatgtccccttaccca
ggaattgacctgtcccaggtgtatgagctgctggagaaggattaccgcatggagcgccca
gaaggctgcccagagaaggtctatgaactcatgcgagcatgttggcagtggaatccctct
gaccggccctcctttgctgaaatccaccaagcctttgaaacaatgttccaggaatccagt
atctctgatgaagtggaaaaggagctggggaaacaaggcatccgtggggctgcgagcacc
ttgctgcaggccccagagctgcccaccaagacgaggacctccaggagagctgcggagcac
agagacgccgccgacgtgcctgaggtgcatcactccaagggccagggagagagtgatcct
ctggaccacgagcttgccgtgtctccattgctccctcgaaaagagcgaggtcccccagag
ggtggcctgaatgaagatgagcgccttctccccaaagacaaaaagaccaacttgttcagc
gccttgatcaagaagaagaagaagacagcaccaacaccccccaaacgcagcagttccttc
cgggagatggacggccagccggagcgcagaggggccggcgaggaagagggccgggacatc
agcaacggggcgctggctcttacccccttggacacagctgacccagccaagtccccaaag
cctagcaacggggctggggtccccaacggagccctccgggagtctgggggctcaggcttc
cgctctccccacctgtggaagaagtccagcacgctgaccagcagccgcctagccactgga
gaggaggatggcggcagcagctccagcaagcgcttcctgcgctcctgctccgcctcctgc
gtgccccatggggccaaggacacagagtggaggtcagtcacactgcctcgggacttgcag
tccactggaagacagtttgactcgtccacatttggagggcacaaaagtgagaagccggct
ctgcctcggaagagggcaggggagaacaggcctgaccaggtgacccgaggcacagtgacg
cccccacccaggctggtgaaaaagaatgaggaagctgctgatgaggtcttcaaagacatc
atggagtctagcccaggctccagcccgcccagcctgactccaaaactcctccgtcggcag
gccatgatggcccctgcctcgggcctccccaacaaggaagaagctgggaagggcggtgcc
ttagggacccctgctgtagctgagccagtgccccccaccagcaaagcgggctcaggtgta
ccagcaggcaccagcaagggtcccaccgaggagtccagagtgaggaggcacaagcactcc
tctgagtcaccaggcagggacaaggggaaattgtccaggctcaaacctgccccgccgccc
ccaccagcagcctctgcagggaaggctggaggaaagccctcacagagcccgagccaggag
gcggccggggaggcaggcctgggagcaaagacaaaagccacaagtctggctgatgctgtg
aacagtgacgctgccaagcccagccagctgggagagggcttcaaaaagccagtactccca
gccactccaaagccacagtccaccaagccatcggggacccccgtcagcccagcccccatt
ccctccacgttgccatcagcatcctcggccctggctggggaccagccatcttccactgcc
ttcatccctctcatatcaacccgcgtgtctcttcggaaaacccgccagcctccagagcgg
atcgccagcggcaccatcaccaagggcgtggtcctggacagcaccgaggcgctgtgcctc
gccatctctaggaactctgagcagatggccagccacagcgcggtcctggaggccggcaaa
aacctctacacgttctgcgtgagctacgtggattccatccagcaaatgaggaacaagttt
gccttccgagaggccatcaacaaactggagaataatctccgggagcttcagatctgcccg
gcgacagcaggcagtggtccggcagccactcaggacttcagcaagctcctcagttcagtg
aaggaaatcagcgacatagtgcagaggtag

DBGET integrated database retrieval system