KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100389264
Entry
100389264         CDS       T03264                                 

Gene name
CGA, CG-alpha, FSH-alpha, LSH-alpha, TSH-alpha
Definition
(RefSeq) glycoprotein hormones, alpha polypeptide
  KO
K08522  glycoprotein hormones alpha chain
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04917  Prolactin signaling pathway
cjc04918  Thyroid hormone synthesis
cjc04923  Regulation of lipolysis in adipocytes
cjc04929  GnRH secretion
cjc05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100389264 (CGA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100389264 (CGA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100389264 (CGA)
   04929 GnRH secretion
    100389264 (CGA)
   04912 GnRH signaling pathway
    100389264 (CGA)
   04913 Ovarian steroidogenesis
    100389264 (CGA)
   04917 Prolactin signaling pathway
    100389264 (CGA)
   04918 Thyroid hormone synthesis
    100389264 (CGA)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100389264 (CGA)
SSDB
Motif
Pfam: Hormone_6
Other DBs
NCBI-GeneID: 100389264
NCBI-ProteinID: NP_001254689
UniProt: P51499
LinkDB
Position
4
AA seq 120 aa
MDYYRKYAAIILITLSVFLHILHSLPDGEFTAEECPECKLKENKYFSRLGSPIYQCMGCC
FSRAYPTPLRSQKTMLVPKNVTSESTCCVAKAYTKATVMGNIRVENHTECHCSTCYHHKF
NT seq 363 nt   +upstreamnt  +downstreamnt
atggattactacagaaaatatgcagctatcattctgatcaccttgtcggtgtttctgcat
attctccattcccttcctgatggcgagtttacagcggaggagtgcccggaatgcaagcta
aaggaaaacaaatacttctccaggctgggttcccccatatatcagtgcatgggctgctgc
ttctctagagcatatcccactccattaagatcccagaagacaatgttggttccaaaaaat
gtcacctcagagtccacttgctgtgtagctaaagcatataccaaggccactgtaatgggg
aacatcagagtggagaaccacacggagtgccactgcagtacttgttatcatcacaaattt
taa

DBGET integrated database retrieval system