KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390556
Entry
100390556         CDS       T03264                                 

Gene name
CTNNA2
Definition
(RefSeq) catenin alpha 2
  KO
K05691  catenin alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04390  Hippo signaling pathway
cjc04520  Adherens junction
cjc04670  Leukocyte transendothelial migration
cjc05100  Bacterial invasion of epithelial cells
cjc05200  Pathways in cancer
cjc05213  Endometrial cancer
cjc05226  Gastric cancer
cjc05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100390556 (CTNNA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100390556 (CTNNA2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100390556 (CTNNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100390556 (CTNNA2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100390556 (CTNNA2)
   05213 Endometrial cancer
    100390556 (CTNNA2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100390556 (CTNNA2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100390556 (CTNNA2)
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100390556 (CTNNA2)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 100390556
NCBI-ProteinID: XP_017819700
UniProt: A0A2R8MPZ2
LinkDB
Position
14
AA seq 953 aa
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGD
PLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQD
NMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTA
GAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANV
PQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGRASQLSTHL
PTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVN
SPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKAMDSF
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgacttcggcaacttcacctatcattttgaaatgggaccccaaaagtttggaaatccgg
acgctaaccgtggaaaggctgttggagccacttgttacacaggtgactacacttgtcaac
acaagcaacaaaggcccatctggtaaaaagaaagggagatcaaagaaagcccacgtacta
gctgcttctgtagagcaagccactcagaacttcctggaaaagggtgaacagatcgctaag
gagagtcaagatctcaaagaagaattggtggctgctgtagaggacgtgcgcaaacaaggt
gagacgatgcgtatcgcctcctccgagtttgctgatgacccatgctcatcggtaaagcgc
ggcaccatggtgcgggcggcaagggctttgctctcggcagtgacacgcttactcatcctt
gcggacatggcagatgtcatgagacttttatcccatctgaaaattgtggaagaggccctg
gaagctgtcaaaaatgctacaaacgagcaagaccttgcaaaccgttttaaagagtttgga
aaagagatggtgaaactcaactatgtagcagcaagaagacaacaggagctgaaggatcct
cactgtcgggatgagatggcagccgcccgaggggctctgaagaagaatgccacaatgctg
tacacggcctctcaagcatttctccgtcacccagatgttgccgctacgagagccaaccga
gattatgtgttcaaacaagtccaggaggccattgctggcatctccaatgctgctcaagct
acctcgcccactgacgaagccaaaggccacacgggcatcggcgagctggctgcggctctt
aatgagtttgacaataagatcatcctggaccccatgacgttcagcgaggccaggttccgg
ccgtccctggaggagaggctggagagcatcatcagcggcgccgcgctgatggcagactcc
tcctgcacacgagacgaccggcgcgagaggatcgtggcggagtgcaacgccgtgcggcag
gcgctccaggacctgctcagcgagtacatgaataatactggaagaaaagaaaaaggagat
cctctcaacattgcgattgataagatgactaagaaaacaagagatttaaggagacagctt
cggaaagcagtgatggatcatatatctgattctttcttggaaaccaatgtccctttgcta
gttctaattgaggctgcaaagagcggaaatgagaaggaagtgaaagaatatgcccaggtt
ttccgtgaacatgccaacaaactggtagaggttgccaatttggcctgttccatctccaac
aatgaagaaggggtgaaattagttcggatggcagccacccagattgacagcctgtgtccc
caggtcatcaatgctgctctgacactggctgcccggccacagagcaaagttgctcaggat
aacatggatgtcttcaaagaccagtgggagaagcaggtccgagtgttgacagaggctgtg
gatgacatcacatcagtggatgacttcctctctgtctcagaaaatcacatcttggaggat
gtgaacaagtgtgtgatagccctccaagagggtgatgtggacactctggaccggactgca
ggggccatcaggggccgagcagctcgagtcatacacatcatcaatgctgagatggagaac
tatgaagctggggtttatactgagaaagtgctggaagctacaaaactgctttctgaaaca
gtgatgccacgctttgctgaacaagtagaggttgccattgaagccctgagtgccaacgtt
cctcaaccatttgaggagaatgagttcatcgatgcctctcgcctggtgtatgatggtgtt
cgagacatcagaaaggctgtgctgatgatcaggaccccagaagaactagaggatgattct
gactttgagcaggaagattacgacgtgcgtagcaggacgagtgttcagactgaggatgac
cagctcattgcagggcagagtgcacgggccatcatggcgcaactaccgcaagaagagaag
gcaaaaatagctgagcaggtggagatattccatcaagagaaaagcaagctggatgcagaa
gtggccaaatgggacgacagcggcaatgatatcattgtactggccaagcagatgtgtatg
atcatgatggaaatgacagacttcacaagaggcaaaggcccattgaaaaatacatctgat
gtcattaatgctgccaagaaaattgctgaagcaggttctcgaatggacaaattagcccgc
gctgtggctgatcagtgtcctgattcagcatgtaagcaggatttattagcctaccttcaa
cgaattgccttgtattgccatcagcttaatatctgcagcaaggtgaaggcggaagtacag
aatctgggaggagagctcattgtgtcagggacaggagttcagagcactttcactaccttt
tatgaggtagattgtgatgtcatagatgggggcagggctagtcaactttctacccacctc
ccaacctgtgctgagggagctccgatcgggagtggaagcagtgattcctccatgctggac
agtgccacatcacttatccaggctgctaaaaacctgatgaatgctgttgtcctcacggtg
aaagcatcctatgtggcctcaaccaaataccagaaggtctatgggacagcagctgtcaac
tcacctgttgtatcttggaagatgaaggctccagagaagaagccccttgtgaagagagaa
aagcctgaagaattccagacacgagttcgacgaggttctcagaagaaacacatttcgcct
gtacaggctttaagtgaattcaaagcaatggattccttctag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100396596
Entry
100396596         CDS       T03264                                 

Gene name
CTNNA3
Definition
(RefSeq) catenin alpha 3
  KO
K05691  catenin alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04390  Hippo signaling pathway
cjc04520  Adherens junction
cjc04670  Leukocyte transendothelial migration
cjc05100  Bacterial invasion of epithelial cells
cjc05200  Pathways in cancer
cjc05213  Endometrial cancer
cjc05226  Gastric cancer
cjc05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100396596 (CTNNA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100396596 (CTNNA3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100396596 (CTNNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100396596 (CTNNA3)
  09162 Cancer: specific types
   05226 Gastric cancer
    100396596 (CTNNA3)
   05213 Endometrial cancer
    100396596 (CTNNA3)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100396596 (CTNNA3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100396596 (CTNNA3)
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100396596 (CTNNA3)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 100396596
NCBI-ProteinID: XP_009008112
LinkDB
Position
12
AA seq 720 aa
MSAETPVTLNIDPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSNRKKGRSKRASVLLA
SVEEATWNLLDKGEKIAQEAAVLKDELTASLEEVRKESEALKVSAERFTDDPCFLPKREA
VVQAARALLAAVTRLLILADMIDVMCLLEHVSAFQRTFESLKNIANKSDLQKTYQKLGKE
LENLDYLAFKRQQDLKSPNRRDEIAGARASLKENSPLLHSICSACLEHSDVPSLKAGKDT
VCEEIQNALDVISNASQGIQNMTALPEPQAATLGSALDELESLIVLNPLTVTEEEIRPSL
EKRLEAIISGAALLADSSCTRDFHRERIIAECNAIRQALQDLLSEYMNNAGKKERSNTLN
VALDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIFHE
HTSRLVEVANLACSMSTNEDGIKIVKIAASHLETLCPQVINAALALAARPKSQVVKNTME
MYKHTWENHIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAI
RGRAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKNSLNV
LDDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEEDHEVRSHTSIQTEGKTDRA
KMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKNMCMIMMEMTDFTR
NT seq 2163 nt   +upstreamnt  +downstreamnt
atgtcagctgaaacaccagtcacactgaatattgatcctcaggatctgcaggtccaaaca
ttcaccgtagagaagctgctggagcctctcataatccaggttaccactcttgtaaactgt
ccccagaacccttccaacaggaaaaaaggacgttcaaaaagagccagtgttcttctagct
tctgtggaagaagcaacttggaatttattagacaagggagagaagattgcccaggaagct
gcagttctaaaggatgagcttactgcttcacttgaggaagttcgtaaagaaagtgaagct
ctgaaagtatcagctgagagattcacagatgacccctgttttctcccaaaaagggaggct
gtggttcaagctgcccgtgccttgctggctgcagtgacgagactccttattcttgcagac
atgattgatgtaatgtgcctcttggagcacgtgtcagcttttcaaaggacatttgagtct
ctcaaaaatattgccaacaaatctgacctccagaaaacctaccagaagcttgggaaggag
ttggaaaatttggattatttagccttcaaacgtcagcaggacttaaaatctccaaatcgg
agggatgaaattgcaggagcccgagcctcattgaaggagaactctcccctcttgcattca
atttgttcagcttgtttggagcattctgatgttccttccctcaaagcaggcaaggacaca
gtttgtgaagaaattcagaatgccctcgatgtcatttcaaatgcttcacaaggcatccag
aatatgacagccctaccagaacctcaggcagcaaccctgggaagtgcccttgatgagctg
gagagtttaattgtcctgaatccactcacagtgactgaggaggaaataagaccatcacta
gagaaacggcttgaagccattatcagtggggctgctctgctggcagactcttcatgcacc
agggacttccaccgggagcggattatcgctgaatgcaacgccattcgccaggctcttcag
gatctgctctcggagtacatgaacaatgctggaaaaaaagaaaggagtaataccctgaat
gttgctttagacaacatgtgtaagaagacaagggaccttcgcagacagctccgcaaggct
attatagatcatgtatcagactctttcttggatacgacagtcccacttttggttctcatt
gaagctgctaagaatggccgggaaaaggaaataaaagaatatgctgcgatatttcatgaa
cacaccagcaggcttgtagaggtggcaaatcttgcttgttccatgtcaacaaatgaagat
ggaattaaaattgtcaaaattgcagccagtcatttggaaaccttatgtccacaggttatt
aatgctgcacttgctttggctgcaagacccaaaagtcaggtggtcaaaaacaccatggaa
atgtacaaacatacttgggagaatcatatacatgtcctcactgaagctgtagatgacatt
acaagcatagatgacttccttgctgtatctgaaagccatatcctggaagatgtcaacaag
tgtatcatagccttaagagaccaggatgctgataatttagaccgtgccgccggtgctatc
agaggccgggcagcaagagttgctcacatcgtcacgggtgaaatggacagttacgagcca
ggggcttacactgaaggtgtaatgagaaacgttaacttccttacaagtactgtaattcct
gaatttgtaacacaagtgaatgttgccttggaagccttaagcaagaactcgttgaatgtg
ttggatgataatcaatttgtggacatctcaaagaaaatctatgatactattcatgatatc
agatgttcagtcatgatgattcggaccccagaggaactggaggatgtttctgaccttgaa
gaggatcacgaggttcgcagtcacaccagtattcagacagaagggaaaactgacagggct
aaaatgactcagctgcctgaggcagaaaaggaaaagattgctgagcaagttgctgatttc
aagaaagtcaagagtaagctggatgctgagattgagatatgggatgatacaagcaatgac
atcattgttctggccaagaacatgtgtatgatcatgatggagatgacagacttcaccagg
taa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100407624
Entry
100407624         CDS       T03264                                 

Gene name
CTNNA1
Definition
(RefSeq) catenin alpha 1
  KO
K05691  catenin alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04390  Hippo signaling pathway
cjc04520  Adherens junction
cjc04670  Leukocyte transendothelial migration
cjc05100  Bacterial invasion of epithelial cells
cjc05200  Pathways in cancer
cjc05213  Endometrial cancer
cjc05226  Gastric cancer
cjc05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100407624 (CTNNA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100407624 (CTNNA1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100407624 (CTNNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100407624 (CTNNA1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100407624 (CTNNA1)
   05213 Endometrial cancer
    100407624 (CTNNA1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100407624 (CTNNA1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100407624 (CTNNA1)
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100407624 (CTNNA1)
SSDB
Motif
Pfam: Vinculin Peptidase_C5
Other DBs
NCBI-GeneID: 100407624
NCBI-ProteinID: XP_008983877
Ensembl: ENSCJAG00000006820
LinkDB
Position
2
AA seq 911 aa
MTAVHAGNINTGNINVKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRS
KKAHVLAASVEQATENFLDKGDKIAKESQFLKEELVAAVEDVRKQGDLMKTAAGEFADDP
CSSVKRGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGM
QYKALKPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVA
AYKANRDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAYALNNFDKQIIVDPLS
FSEERFRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNA
GRKERSDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKE
VKEYAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKP
QSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDV
DGLDRTAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAV
EALSTDPAQPMDENEFIDASRLAYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTS
VQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVL
AKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQD
LLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKA
SYVASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQ
ALSEFKAMDSI
NT seq 2736 nt   +upstreamnt  +downstreamnt
atgactgctgttcacgcaggcaacataaacacaggcaacataaatgtcaagtgggacccc
aaaagtctggagatcaggactctggcagttgagagactgttggagccccttgttacacag
gttacaaccctggtaaacaccaatagtaaggggccctctaataagaagagaggtcgttcc
aagaaggctcatgttttggctgcatctgttgaacaagcaactgagaatttcttggacaag
ggggataaaattgcaaaggagagccagtttctcaaggaggagcttgtggctgctgtagaa
gatgttcgaaaacaaggtgatttgatgaagactgccgcgggagagttcgcagatgatccc
tgctcttctgtgaagcgaggcaacatggttcgggcagctcgagctttgctctctgctgtt
acccggttgctgattttggctgacatggcagatgtctacaaattacttgttcagctgaaa
gttgtggaagatggtatcttgaagttaaggaatgctggcaatgaacaagacttaggaatg
cagtataaagccctaaaacctgaagtggataagctgaacattatggcagccaaaaggcaa
caggaactgaaagatgttggccatcgtgatcagatggctgcagctagaggaatcctgcag
aagaatgttccgatcctctatactgcatcccaggcatgcctacagcaccctgatgtcgca
gcctataaggccaacagggacctgatatacaagcagctgcagcaggcggtcacgggcatt
tccaatgcagcccaggccactgcctcagacgatgcctcccagcaccaggggggaggagga
ggagaactggcatatgcactcaataactttgataaacaaatcattgtggaccccttgagc
ttcagtgaggagcgctttaggccttccctggaggagcgtctggaaagcatcattagcggg
gctgccttgatggccgactcatcctgcactcgtgacgatcgtcgtgagcgaattgtggca
gaatgtaatgctgttcgccaggccctgcaggacctgctttctgagtacatgggcaatgct
ggacgtaaagaaagaagtgatgcactcaattctgcaatagataaaatgaccaagaagacc
agggacttgcgtagacagctccgcaaagctgtcatggaccatgtttcagattcttttctg
gaaaccaatgttccacttttggtattgattgaagctgcaaagaatggaaatgagaaagaa
gttaaggagtatgcccaagtttttcgtgaacatgccaacaagttaattgaggttgccaac
ttggcctgttccatctcaaataatgaagaaggtgtaaagcttgttcgaatgtctgcaagc
cagttagaagccctctgtcctcaggttatcaacgctgcattggctttagcagcaaaacca
cagagtaaactggcccaagagaacatggatctttttaaagaacaatgggaaaaacaagtc
cgtgttctcacagatgctgtcgatgacataacttccattgatgacttcttggctgtctca
gagaatcacattttggaagatgtgaacaaatgtgtcattgctctccaagagaaggatgtg
gatggcctggaccgcacagctggtgcaattcgaggccgggcagcccgggtcattcacgtg
gtcacctcagagatggacaactatgagccaggagtctacacagagaaggttctggaagcc
actaagctgctctctaacacagtcatgccacgttttactgagcaagtagaagcggccgtg
gaagccctcagcacggaccctgcccagcccatggatgagaatgagtttatcgatgcctcc
cgcctggcatatgatggcatccgggacatcaggaaagcagtgctgatgataaggacccct
gaggagttggatgactctgactttgagacggaagatttcgatgtcagaagtaggacgagt
gtccagacagaagacgatcagctgatagctggccagagtgcccgggcgatcatggctcag
cttccccaggagcagaaagcgaagattgcagaacaggtggccagcttccaggaagaaaag
agcaagctggatgctgaagtgtccaaatgggatgacagtggcaatgacatcattgtgctg
gccaagcagatgtgcatgattatgatggagatgactgactttacccgaggtaaaggacca
ctcaaaaatacatcagatgtcatcagtgctgccaagaaaattgctgaggcaggatccagg
atggacaagcttggccgcaccattgcagaccactgccccgactcggcctgcaagcaggac
ctgctggcctacctgcaacgcatcgccctctactgccaccagctcaacatctgcagcaag
gtcaaggctgaggtgcagaatctcggcggggagcttgttgtctctggggtggacagcgcc
atgtccctgatccaggcagccaagaacttgatgaatgccgtggtccagaccgtgaaggca
tcttacgtcgcctctaccaaataccaaaagtcgcagggtatggcttccctcaaccttcct
gctgtgtcatggaagatgaaggcaccagagaaaaagcccttggtgaagagagagaaacag
gatgagacacaaaccaagattaaacgggcatctcaaaagaagcacgtgaacccagtgcag
gccctcagtgagttcaaagccatggacagcatctag

DBGET integrated database retrieval system