KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390670
Entry
100390670         CDS       T03264                                 

Gene name
ADCYAP1
Definition
(RefSeq) adenylate cyclase activating polypeptide 1
  KO
K05262  pituitary adenylate cyclase-activating polypeptide
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04080  Neuroactive ligand-receptor interaction
cjc04713  Circadian entrainment
cjc04911  Insulin secretion
cjc04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100390670 (ADCYAP1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100390670 (ADCYAP1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100390670 (ADCYAP1)
   04924 Renin secretion
    100390670 (ADCYAP1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100390670 (ADCYAP1)
SSDB
Motif
Pfam: Hormone_2 Spexin
Other DBs
NCBI-GeneID: 100390670
NCBI-ProteinID: XP_002757148
Ensembl: ENSCJAG00000000097
LinkDB
Position
13
AA seq 338 aa
MNKNRSATVQQNILYLKATGRQVLTKKSFQKPCSDRFLLTARINTSRRPVNSVTTGSSRR
IRPLPHRPLFLSSISLSSPPSLRVTLSPSSARLQTFEQNTSLGKQVLQLLLLLLLVPAAS
AQTPTPDGDASRVVTPAQKLEGALCPPSYLAAHPLLTAVRVEGMTMCSGARLALLVYGII
MHSSVYCSPAASGLRFPGIRPEEEAYDEDGTPLQDFYDLESPGAGSPASALRDAFTLYYP
VERRDVAHGILNKAYRKVLDQLSARKYLQSLVAKGVGGSLGGAEDDAEPLSKRHSDGIFT
DSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaataaaaatcggagcgcaacagtgcaacaaaatattctgtacttaaaggcaacaggc
agacaggtgttgacaaagaagtctttccaaaaaccgtgttcggatagatttttgctaact
gcacggataaatacgagcagaaggccggtcaactctgtaaccaccggcagcagcagaaga
atccgccctttacctcatcgccccctctttctttcttctatatctctctcttcgccccct
tctctccgtgtcacgctctctcctagttctgcgcgtctacaaacttttgaacagaataca
agcctcggcaaacaagtcctgcagctcctcctgctgctcctgctcgttcctgcggcttct
gctcagacaccgacgccagacggtgatgcctctcgggttgtgactccagcgcagaaactt
gaaggagccctttgccccccgtcctacttggcagcacaccctctcctgacagcggtaaga
gttgaaggaatgaccatgtgtagcggagcgaggctggccctgctggtctatgggataatc
atgcacagcagcgtctactgctcacctgccgcctccggactccggttccccgggatcagg
ccagaggaagaggcgtacgacgaggacggaaccccgctgcaagacttctacgacttggag
tcgcctggcgcagggagccccgcctccgcgctgcgcgacgccttcacgctgtactacccg
gtggagaggagagatgtcgcccacgggattcttaacaaggcctaccgcaaagtgctggac
cagctgtccgccaggaagtacctgcagtcgctcgtggccaagggcgtgggtgggagccta
ggcggcgcggaggacgacgcggagccgctctccaagcgccactcggacggaatcttcacg
gacagctacagtcgctaccggaaacaaatggctgtcaagaaatacttggcggcggttcta
gggaaaaggtataaacaaagggttaaaaacaaaggacgccgaatagcgtatttgtag

DBGET integrated database retrieval system