KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100390910
Entry
100390910         CDS       T03264                                 

Gene name
CD44
Definition
(RefSeq) CD44 molecule (Indian blood group)
  KO
K06256  CD44 antigen
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04512  ECM-receptor interaction
cjc04640  Hematopoietic cell lineage
cjc05169  Epstein-Barr virus infection
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100390910 (CD44)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100390910 (CD44)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100390910 (CD44)
   05205 Proteoglycans in cancer
    100390910 (CD44)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100390910 (CD44)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100390910 (CD44)
   04090 CD molecules [BR:cjc04090]
    100390910 (CD44)
   00535 Proteoglycans [BR:cjc00535]
    100390910 (CD44)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100390910 (CD44)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100390910 (CD44)
  Exosomal proteins of other body fluids (saliva and urine)
   100390910 (CD44)
  Exosomal proteins of colorectal cancer cells
   100390910 (CD44)
  Exosomal proteins of bladder cancer cells
   100390910 (CD44)
CD molecules [BR:cjc04090]
 Proteins
  100390910 (CD44)
Proteoglycans [BR:cjc00535]
 Cell surface proteoglycans
  Others
   100390910 (CD44)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Hyaluronan
  Cell surface receptors
   100390910 (CD44)
SSDB
Motif
Pfam: Xlink
Other DBs
NCBI-GeneID: 100390910
NCBI-ProteinID: XP_002755221
Ensembl: ENSCJAG00000010912
LinkDB
Position
11
AA seq 742 aa
MDKFWWRAAWGLCLVQLSLAQIDLNITCRFEGVYHVEKNGRYSISRTEAADLCKAFNSTL
PTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN
ASAPPGEDCTSVTDLPNAFDGPITITIVNRDGTRYVKKGEYRTNPEDINPSSPTDDDVSS
GSSSERSSTSGGYIFYNHFSTSPPIPDEDSPWITDSTDRTPATTLMSISATATETATKRQ
EIQDWFSWWFPPSESKHHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDD
DEDFISSTISTTPRLFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAHERNW
NQEAHASLIHYEHHEEEEIPHSTSTIQATPGSTNEETATQKEQWFGNRWHEGYLHTPRED
SHSTTGTAASAHTSHSTQGTTTSSPEDSSWTDFFDPVSHPMGRGHQAGRRMDMDSSHSTK
LQPTADPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDV
RGGRRGPSHFEPSTTLLEGYTSPYPDSKESRTFIPGTPDETGSFGVTDVTVGDSNSNVNH
SLSGDQGAFDPRGGSHTTHGSESAGHSHGSQEGGANTTSGPLRTPQIPEWLIILASLLAL
ALILAVCIAVNSRRRCGQKKKLVINNGNGAVEDRKSSGLNGEASKSQEMVHLVNKESSET
PDQFMTADETRNLQNVDMKIGV
NT seq 2229 nt   +upstreamnt  +downstreamnt
atggacaagttttggtggcgcgcagcctggggactctgcctcgtgcagctgagcctggcg
cagatcgatttgaatataacctgccgcttcgaaggtgtataccacgtggagaaaaatggt
cgctatagcatctctcggacggaggcagctgacctctgcaaggctttcaatagcaccttg
cccacaatggcccagatggagaaagctctgagcatcgggtttgagacctgcaggtatggg
ttcatagaagggcacgtggtgattcctcggatccaccccaactccatctgtgcagcaaac
aacacaggggtgtacattctcacgtccaacacctcccagtatgacacatattgcttcaat
gcttcagctccaccaggagaagattgtacatcagtcacagacctgcccaatgcctttgat
ggaccaattaccataactattgttaaccgcgacggcacccgctatgtcaagaaaggagaa
tacagaacgaatcctgaggacatcaaccccagcagccctactgacgacgatgtaagcagt
ggatcctccagtgaaaggagcagcacttcaggaggttacatcttttataaccacttttca
acttcaccacccatcccagatgaagacagtccctggatcaccgacagcacagacagaacc
cctgcaaccactttgatgagcattagtgccacagcaactgagacagcaaccaagaggcaa
gaaatccaggactggttttcatggtggtttccaccatcggagtccaagcatcatcttcac
acaacaacacaaatggctggtacgtcttcaaataccatctcagcaggctgggagccaaat
gaagaaaatgaagatgaaagagacagacacctcagtttttctggatcaggcattgatgat
gatgaagattttatctccagcaccatttcaaccacaccacggctttttgaccacacaaaa
cagaaccaagattggacccagtggaacccaagccattcaaatccagaagtgctacttcag
acaaccacaaggatgactgatgtagacagaaatggtaccactgctcatgaaagaaactgg
aaccaggaagcacacgcttccctcattcactatgagcatcacgaggaagaagagatccca
cattctacaagcacaatccaggcaactcctggtagtacaaatgaagaaacagctacccag
aaggaacagtggtttggcaacagatggcatgagggatatctccacacgcccagagaagac
tcccattcaacaacagggacagctgcctcagcccacaccagccattcaacccaaggaaca
acgacatcaagcccagaggacagttcctggactgatttcttcgacccagtctcacatccc
atgggacgaggtcatcaagcaggaagaaggatggatatggactccagtcatagtacaaag
cttcagcctactgcagatccaaatacaggtttggtggaagacttggacaggacaggacct
ctttcaatgacaacgcagcagagtaactctcagagcttctctacatcacatgaaggcttg
gaagaagataaagaccatccaacaacttctactctgacatcaagtaatagaaatgatgtc
agaggtggaagaagaggcccaagtcattttgaaccttcaactactttactggaaggttat
acttctccttacccagactcaaaggaaagcaggaccttcatcccagggaccccagatgag
actgggtcctttggagttactgatgttactgttggagattccaactctaatgtcaatcac
tccttatcaggagaccaaggtgcattcgaccccagggggggctcccataccactcatgga
tctgaatcagctggacattcacatgggagtcaagaaggtggggcaaacacaacctccggt
cctttaaggacaccccaaattccagaatggctgatcatcttggcatccctcttggccttg
gctttgattcttgcagtttgcattgcagtcaacagtcgaagaaggtgtgggcagaagaaa
aagctagtgatcaacaatggcaatggagctgtggaggacagaaagtcaagtggactcaac
ggagaggccagcaagtctcaggaaatggtgcatttggtgaacaaggagtcctcagaaact
ccagaccagtttatgacagctgatgaaacaaggaacctgcagaacgtggacatgaagatt
ggggtgtaa

DBGET integrated database retrieval system