KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391152
Entry
100391152         CDS       T03264                                 

Gene name
PIAS2
Definition
(RefSeq) protein inhibitor of activated STAT 2
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100391152 (PIAS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100391152 (PIAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100391152 (PIAS2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     100391152 (PIAS2)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100391152 (PIAS2)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 100391152
NCBI-ProteinID: XP_002757259
Ensembl: ENSCJAG00000008117
LinkDB
Position
13
AA seq 606 aa
MVLEAESAVVAAASLAAVGVGAAAAAAAPRGWYKMADFEELRNMVSSFRVSELQVLLGFA
GRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRTLEGLSDLSTIKSSVFSLD
GSSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGSVLLQDTKPTFEMQQPSPPIPPVHPDV
QLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYT
VQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSL
VRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEK
LTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICP
VCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMRPKKEAMKVSSQLCTKIES
SSVLSKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAKRKCIFMSETQSSPTKGVLM
YQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPISSMSSDLPGEQRRNDINNELALGTS
SDTVQQ
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggtgctggaggctgagtcggccgtggtggcggcggcgtcgttggcggcagtgggagtg
ggtgcggcggcagcggcggcggcgccccgcgggtggtataaaatggcggatttcgaagag
ttgaggaatatggtttctagttttagggtttctgaactacaagtattactaggctttgct
ggacggaataaaagtggacgcaagcatgacctcctgatgagggcgctgcatttattgaag
agtggctgcagccctgcggttcagattaaaatccgagaattgtatagacgccgatatcca
cgaactcttgaaggactttctgatttatccacaatcaaatcatcggttttcagtttggat
ggtagctcatcacctgtagaacctgacttggccgtggctggaatccactcgttgccttcc
acttcagttacacctcactcaccatcctctcctgttggttctgtgctgcttcaagatact
aagcccacatttgagatgcagcagccatctcccccaattcctcctgtccatcctgatgtg
cagttaaaaaatctgcccttttatgatgtccttgatgttctcatcaagcccacgagttta
gttcaaagcagtattcagcgatttcaagagaagttttttattttcgctttgacacctcag
caagttagagagatatgcatatccagggattttttgccaggtggtaggagagattataca
gtacaagttcagttgagactttgcctggcagaaacaagttgccctcaagaagataactat
ccaaatagtctatgtataaaagtaaatgggaagctatttcctttgcctggctacgcacca
ccacctaaaaatgggattgaacagaagcgccctggacgccccttgaatattacatcttta
gttaggttatcttcagctgtgccaaaccaaatttccatttcttgggcatcagaaattggg
aagaattactccatgtctgtgtatcttgtacgacagcttacatcagccatgttgttacag
agattaaaaatgaaaggtattagaaaccctgatcattccagagcactaataaaggaaaaa
cttactgcagatcctgatagtgaaattgctacaactagccttcgggtatccttgatgtgc
cctttaggaaaaatgaggctgacaatcccatgccgtgcagtgacttgtacacatctgcag
tgttttgatgctgccctttatttacaaatgaatgagaagaagcccacctggatttgtcct
gtatgtgacaaaaaagctgcctatgaaagtttaatattagatgggctttttatggaaatt
ctcaatgactgttctgatgtggatgagatcaaattccaagaagatggttcttggtgtcca
atgagaccgaagaaagaagctatgaaagtatccagccaactgtgcacaaaaatagaaagt
tcaagtgtcctcagtaagccttgttcagtgactgtagccagtgaggcaagcaagaagaaa
gtagatgttattgatcttacaatagaaagctcttctgatgaagaggaagaccctcctgcc
aaaaggaaatgcatctttatgtcagaaacacaaagcagcccaaccaaaggggttctcatg
tatcagccatcttctgtaagggtgcccagtgtgacttcggttgatcctgctgctattccg
ccttcattaacagactactcagtaccattccaccacacgccaatatcaagcatgtcatca
gatttgccaggagaacaaagaagaaatgatattaataatgaactggcgcttggaacatct
tctgatactgtgcaacagtga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393272
Entry
100393272         CDS       T03264                                 

Gene name
PIAS4
Definition
(RefSeq) protein inhibitor of activated STAT 4
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04630  JAK-STAT signaling pathway
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100393272 (PIAS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100393272 (PIAS4)
   04064 NF-kappa B signaling pathway
    100393272 (PIAS4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100393272 (PIAS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100393272 (PIAS4)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100393272 (PIAS4)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100393272 (PIAS4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP
Other DBs
NCBI-GeneID: 100393272
NCBI-ProteinID: XP_002761632
Ensembl: ENSCJAG00000015065
UniProt: F7HES4
LinkDB
Position
22
AA seq 509 aa
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYKKTSESVPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLGR
LPTKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSRE
LQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCR
PINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCKA
LVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKP
TWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGTI
LVLGPSDASGLLPTPSVNGSSALGSTGGGGPAGSVENGKPGTDVVDLTLDSSSSSEDEEE
EEEEDEDEDDEGPRPKRRCPFQKGLVPAC
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggcggcggagctggtggaggccaaaaacatggtgatgagttttcgagtctccgacctt
cagatgctcctgggtttcgtgggccggagtaagagcggactgaagcacgagcttgtcacc
agagccctccagctggtgcagtttgactgtagcccagagctgttcaagaagatcaaggag
ctgtacgagacccgctataagaagacctcggagtctgtgccacagccgcaccggcccctg
gaccccctgaccatgcactccacctacgaccgggccggcgccgtgcccaggactccgctg
gcgggccccaatattgactaccctgtgctctacgggaagtacttaaatggactgggacgg
ttgcccaccaagaccctcaagccagaagtccgcctggtgaagctgcccttctttaatatg
ctggacgagctgctgaagcccactgagttagtcccacagaacaacgagaagcttcaggag
agcccgtgcatcttcgcgttgacaccaagacaggtggagctgatccggaactccagagaa
ctgcagcccggagtcaaagccgtgcaggtcgtccttagaatctgctactcagacaccagc
tgccctcaggaggaccagtacccacccaacatcgccgtgaaggtcaaccacagctactgc
tcagtcccgggttactacccatccaataagcctggggtggagcccaagaggccatgccgc
cccatcaacctcacccacctcatgtacctgtcctcggccaccaaccgcatcaccgtcacc
tgggggaactatggcaagagctactcagtggccctgtacctggtacggcagctgacctcg
tcagagctgctgcagaggctgaagaccattggggtgaagcacccagagctgtgcaaggcg
ctggtcaaggagaagctgcgcctcgatcccgacagcgagattgccaccactggggttcgg
gtgtccctcatctgcccgctggtgaagatgcggctctctgtgccttgccgggcagagacc
tgcgcgcacctgcagtgcttcgacgccgtcttctacctgcagatgaatgagaagaagccc
acctggatgtgcccggtgtgcgacaagccagccccctacgaccagctcatcatcgatggc
ctcctctcgaagatcctgagcgagtgtgaggacgccgacgagatcgaatacctggtggac
ggctcatggtgcccaatccgtgccgagaaggagcgcagctgcagcccacagggcaccatc
ctcgtgctgggcccctcagatgccagtgggctcctgcccactcccagtgtcaacgggagt
agtgcactgggcagcacgggtggcggcggcccagcgggcagtgtggagaatgggaaaccg
ggcacagacgtggtggacctcacgctggacagctcatcgtcctcggaggatgaggaggaa
gaggaggaggaggacgaggacgaggacgacgagggcccccggcccaagcgccgctgcccc
ttccagaagggcctggtgccagcctgctga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399947
Entry
100399947         CDS       T03264                                 

Gene name
PIAS1
Definition
(RefSeq) protein inhibitor of activated STAT 1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04630  JAK-STAT signaling pathway
cjc05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100399947 (PIAS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100399947 (PIAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100399947 (PIAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100399947 (PIAS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cjc04812]
    100399947 (PIAS1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     100399947 (PIAS1)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100399947 (PIAS1)
Cytoskeleton proteins [BR:cjc04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    100399947 (PIAS1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 100399947
NCBI-ProteinID: XP_017832204
Ensembl: ENSCJAG00000002224
UniProt: U3D8K3
LinkDB
Position
10
AA seq 651 aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaactccaa
gtactgttgggctacgctgggagaaacaagcacggacgcaaacacgaacttctcacaaaa
gccctgcatttgctaaaggctggctgtagtcctgctgtacaaatgaaaattaaggaactc
tataggcggcgtttcccgcagaaaatcatgacgcctgcagacttgtccatccccaacgta
cattcaagtcctatgccagcaactttatctccatctaccattccacagctcacttatgat
ggtcaccctgcatcatcaccattactccctgtttctcttctgggacctaaacatgaactg
gaactcccacatcttacatcagctcttcacccagtccatccggatataaaacttcaaaaa
ttaccgttttatgatttactggatgaactgataaaacccaccagtctagcatcagacaac
agtcagcgctttcgagaaacctgttttgcatttgccttgacaccacaacaagtgcagcaa
atcagtagttccatggatatttctgggaccaaatgtgacttcacagtacaggtccagtta
aggttttgtttatcagaaactagttgtccacaagaagatcacttcccacccaatctttgt
gtgaaagtgaatacaaaaccttgcagccttccaggttaccttccacctacaaaaaatggc
gtggaaccaaagcgacccagccgaccaataaatatcacctcacttgtccgactgtccaca
acagtaccaaacacaattgttgtttcttggactgcagaaattggaagaaactattccatg
gcagtatatcttgtaaaacagttgtcctcaacagttctgcttcagagattacgagcaaag
ggaataaggaatccggatcactctagagctttaattaaagagaagttgactgcggatcca
gatagtgaaatagctacaaccagcctaagggtttctctactgtgtccacttggtaaaatg
cggctgacaattccgtgtcgggcccttacatgctctcacctacaatgttttgacgcaact
ctttacattcagatgaatgagaaaaaaccaacctgggtttgtcctgtctgtgataagaag
gctccatatgaacaccttattattgatggcttgtttatggaaatcctaaagtactgcaca
gattgtgatgaaatacaatttaaggaggatggctcttgggcaccaatgagatcgaaaaag
gaagtacaggaagtttctgcctcatacaatggagttgatggatgcttgagctccacattg
gagcatcaggtagcttctcaccaccagtcctcaaataaaaacaagaaagtagaagtgatt
gacctaaccatagacagttcatctgatgaagaggaagaagagccatctgccaagaggacc
tgtccttccctgtctcccacatcaccactaaataataaaggcattttaagtcttccacat
caagcatctccagtatcccgcaccccgagccttcctgctgtagacacaagctacattaat
acctccctcatccaagactataggcatcctttccacatgacacccatgccttatgactta
caagggttagattttttccctttcttatcaggagacaatcagcattacaacacctccttg
cttgccgctgcggcagcagcagtttcagatgatcaagacctcctgcactcgtctcggttt
tttccgtatacctcctcacagatgtttcttgatcagttaagtgcaggaggcagtacttct
ctgccaaccaccaatggaagcagtagtggcagtaacagcagcctggtttcctccaacagc
ctaagggagagccatagccacactgtcacaaacaggagcagcacggacacagcatccatt
tttggcatcataccagacattatttcattggactaa

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100401461
Entry
100401461         CDS       T03264                                 

Gene name
PIAS3
Definition
(RefSeq) protein inhibitor of activated STAT 3
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100401461 (PIAS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100401461 (PIAS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    100401461 (PIAS3)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     100401461 (PIAS3)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100401461 (PIAS3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 100401461
NCBI-ProteinID: XP_002759863
Ensembl: ENSCJAG00000002257
UniProt: U3FA04
LinkDB
Position
18
AA seq 628 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKALGPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTVVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQEGNPSENKKKVEVIDLTVESSSDEEDLPPTKKHCSVTSAVIPALPG
SKGVLTPGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGAEIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPAHFLGPLAPTLGSSHRSATPAPPPGRVSSIVAPG
GALREGHGGPLPSGPSLTGCRSDIISLD
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggcggagctgggcgaattaaagcacatggtgatgagtttccgggtgtctgagctccag
gtgcttcttggctttgctggccggaacaagagtggacggaagcacgagctcctggccaag
gccctgcacctcctgaagtccagctgtgcccctagtgtccagatgaagatcaaagagctt
taccgacgtcgctttccccggaaggccctggggccctctgatctctccctgctctctttg
ccccctggcacctctcctgtaggctcccctggccctctagctcccattcccccaaccctg
ttggcccctggcaccctgctgggccccaagcgtgaggtggacatgcacccccctctgccc
cagcctgtgcaccctgatgtcaccatgaaaccattgcccttctatgaggtctacggggag
ctcattcggcccaccacccttgcatccacttccagccagcggtttgaggaagcacacttt
acctttgccctcacaccccagcaagtgcagcagattcttacatccagagaggttctgcca
ggagccaaatgtgattacaccatacaggtgcagctaaggttctgtctctgtgagaccagc
tgcccccaggaagattatttccccccgaacctctttgtcaaggtcaacgggaaactgtgc
cccctgccgggttaccttcccccaaccaagaatggggctgagcccaagaggcccagccgc
cccatcaacatcacacccctggctcgactctcagccactgttcctaacactgttgtggtc
aattggtcatctgagttcggacggaattactccttgtctgtgtacctggtgaggcagttg
acagcagggacccttctacagaaactcagagcaaagggtatccggaacccagatcactcg
agggcactgatcaaggagaaattgactgctgaccctgacagtgaggtggccactacgagt
ctccgggtgtcactcatgtgcccgctagggaagatgcgtctgactgtcccttgtcgtgcc
ctcacctgcgcccacctgcagagtttcgatgctgccctttacctacagatgaatgagaag
aagccaacatggacatgtcctgtgtgtgacaagaaggctccctatgaatctcttatcatt
gatggtttatttatggagattcttagttcctgttcagattgtgatgagatccagttcatg
gaagatggatcctggtgcccaatgaaacccaagaaggaggcatctgaggtttgccccccg
ccagggtatgggctggatggcctgcagtacagcccagtccaggagggaaatccatcagag
aataagaaaaaggttgaagttattgacttgacagtagaaagctcatcagatgaggaggat
ctgcccccaaccaagaagcactgttctgtcacctcagctgtcatcccagccctacctgga
agcaaaggagtcctgacgcctggccaccagccatcctcggtgctaaggagccctgccatg
ggcacgttgggtggggatttcctgtccagtctcccactacatgagtacccacctgccttc
ccactgggagccgaaatccaaggtttagatttattttcatttcttcagacagagagtcag
cactacggcccctccgtcatcacctcactagatgaacaggatgcccttggccacttcttc
cagtaccgagggacccctgctcactttctgggcccactggcccccacgttggggagctcc
caccgcagcgccactccggcaccccctcctggccgtgtcagcagcattgtggcccctggg
ggggccttgagggaggggcatggaggacccctgccttcaggtccctctttgactggctgt
cggtcagacatcatttccctggactga

DBGET integrated database retrieval system