KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100391217
Entry
100391217         CDS       T03264                                 

Gene name
PLD2
Definition
(RefSeq) phospholipase D2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00564  Glycerophospholipid metabolism
cjc00565  Ether lipid metabolism
cjc01100  Metabolic pathways
cjc04014  Ras signaling pathway
cjc04024  cAMP signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04144  Endocytosis
cjc04666  Fc gamma R-mediated phagocytosis
cjc04724  Glutamatergic synapse
cjc04912  GnRH signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc05200  Pathways in cancer
cjc05212  Pancreatic cancer
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100391217 (PLD2)
   00565 Ether lipid metabolism
    100391217 (PLD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100391217 (PLD2)
   04072 Phospholipase D signaling pathway
    100391217 (PLD2)
   04071 Sphingolipid signaling pathway
    100391217 (PLD2)
   04024 cAMP signaling pathway
    100391217 (PLD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100391217 (PLD2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100391217 (PLD2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100391217 (PLD2)
   04928 Parathyroid hormone synthesis, secretion and action
    100391217 (PLD2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100391217 (PLD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100391217 (PLD2)
   05231 Choline metabolism in cancer
    100391217 (PLD2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100391217 (PLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100391217 (PLD2)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     100391217 (PLD2)
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100391217 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    100391217 (PLD2)
SSDB
Motif
Pfam: PX PLDc_2 PLDc PH PH_2
Other DBs
NCBI-GeneID: 100391217
NCBI-ProteinID: XP_002748329
Ensembl: ENSCJAG00000011918
UniProt: F7AVC9
LinkDB
Position
5
AA seq 933 aa
MTATPESLFPTGGDLDSSQLQMESDEVNTLREGEDPADRMHPFLAIYDLQPLKVHPLVFA
TGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLLRHKVL
MSLLPLARFAVAYSPAREAANREIPSLPRAGPEGSTRHAASKQKYLENYLNRLLTMSFYR
NYHALTEFLEVSQLSFIPDLGCKGLEGMIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
KDSFLLYMCLETGTISFVQLFDPGFEVQVGKRSTEARYGVRIDTSHRSLILKCSSYRQAR
WWAQEITELAQGPGRDFLYLHRHDSYAPPRPGTLAQWFVNGAGYFAAVADAILRAQEEIF
ITDWWLSPEVYLKRPAHSDDWRLDIMLKRKAEEGVRVSVLLFKEVELALGINSGYSKRAL
MLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSE
SAASQPPTPCPDSSATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFINRETTPRMPW
RDVGVVVHGLPARDLARHFIQRWNFTKTTKAKYKIPTYPYLLPKSTCTANQLPFTLPGGQ
CTTVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDE
IVDRILKAHKQGQCFRVYLLLPLLPGFQGDISTGGGNSIQAILHFTYRTLCRGEYSILHR
LKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKMLIADDRTVIIGSANINDRSLL
GKRDSELAVLIEDTETEPSLMNGAEYQAGRFALSLRKHCFSVILGANARPDLDLRDPVCD
DFFQLWQETAESNASIYEQIFRCLPSNATRSLRTLREYVAVEPLAVVSPPLALSELTQVQ
GHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgacggcgacccctgagagcctcttccccactgggggcgacctagactccagccagctc
cagatggagtccgatgaggtgaacactctgagagagggagaggacccagccgaccggatg
cacccgtttctggccatctatgatcttcagcctctgaaagtgcatcccttggtgtttgca
actggggtccctgtcacagcccaggtggtgggcactgaaagatataccagcggatccaag
gtgggaacctgcactctgtattctgtccgcttgactcacggcgactttacctggacaacc
aagaagaagttccgtcattttcaggagctgcatcgggacctcctgagacacaaagtcttg
atgagtctgctccccctggctcgttttgccgttgcctattctccagcccgagaggcagcc
aacagagagattccctctctaccccgagcaggtcctgagggctccaccagacatgcagcc
agcaaacagaaatacctggagaattacctcaaccgcctcttgaccatgtctttctatcgc
aactaccatgccctgacagagttcctggaagtcagtcagctgtcttttatcccagacctg
ggctgcaaaggactggaggggatgatccggaagcgctcaggtggccaccgagttcctggc
ctcacctgctgtggccgagaccaagtttgttatcgctggtccaagaggtggctggtggtg
aaggattccttcctgctgtacatgtgcctcgagacgggcaccatctcatttgttcagctc
tttgaccctggctttgaggtgcaggtggggaaacggagcacggaggcacggtacggtgtg
cggatcgatacctctcacaggtccttgattctcaagtgcagcagctaccggcaggcacgg
tggtgggcccaggagatcaccgagctggcacagggccctggaagagacttcctatatctg
caccggcacgacagctacgccccaccccggcctgggaccttggcccagtggtttgtgaat
ggggcaggttactttgctgctgtggcagatgccatccttcgagcccaagaggagattttc
atcacagactggtggttgagtcctgaggtttacctgaagcgtccagcccattcagacgac
tggagactggacattatgctcaagaggaaggcggaggagggtgtccgtgtgtctgttttg
ctgtttaaggaagtggaattggccttgggcatcaacagtggctatagcaagagggcactg
atgctgctgcaccccaacataaaggtgatgcgtcacccagaccaagtgacgttgtgggcc
catcatgagaagctcctggtggtggaccaagtggtagcattcctggggggactggacctt
gcctatggccgctgggatgacctgcactaccgactgactgaccttggagactcctctgaa
tcggctgcctcccagcctcctaccccgtgcccagactcatcagccaccccagacctctct
cataaccaattcttctggctgggcaaggactacagcaatcttatcaccaaggactgggtg
cagctggaccggcctttcgaagatttcatcaacagggagacgacacctcggatgccatgg
cgggacgttggggtagtcgtccatggcctacctgcccgggacctcgcccggcacttcatc
cagcgctggaatttcaccaagaccaccaaggccaagtacaagattcccacgtacccttac
ctgcttcccaagtctacctgcactgccaaccagctccccttcacactcccaggggggcag
tgcaccactgtgcaggtcttgcggtcagtggaccgctggtcagcagggactctggagaac
tccatcctcaatgcctacctgcacaccatcagggagagccagcacttcctctacattgag
aatcagttcttcattagctgctcagatgggcggacggttctgaacaaggtgggcgatgag
attgtggacagaatcctgaaggcccacaaacaggggcagtgtttccgagtctacttgctt
ttgcccttactccctggcttccagggtgacatctccacaggtggtggcaactccatccaa
gccattctgcacttcacttacaggaccctgtgtcgtggggagtattcaatcctgcatcgc
ctcaaagcagccatgggaacagcatggcgggactacatttccatctgcgggcttcgtaca
catggagagctgggcgggcacccagtctcagagctcatctacatccacagcaagatgctc
attgcagatgaccggacagtcatcataggttctgcaaacatcaatgaccggagcttgctg
gggaagcgggacagtgagctggccgtgctgatcgaggacacagagacagaaccatccctc
atgaatggggcagagtatcaggcgggcaggtttgccttgagtttgcggaagcactgcttc
agtgtgattcttggagcaaatgcccggccagacttggatctccgagaccctgtctgtgat
gacttcttccagttgtggcaagagacagctgagagcaatgccagtatctatgagcagatc
ttccgctgcctgccatccaatgccacacgttccctgcggacactccgggagtatgtggcc
gtggagcctctggccgtggtcagtccacccttggctctgtctgagctcacccaggtccag
ggtcacctggtccacttcccactcaagttcctagaggatgaatctttgctgcccccgctg
ggtagcaaggagggcatgatccccctggaagtgtggacatag

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100397093
Entry
100397093         CDS       T03264                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00564  Glycerophospholipid metabolism
cjc00565  Ether lipid metabolism
cjc01100  Metabolic pathways
cjc04014  Ras signaling pathway
cjc04024  cAMP signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04144  Endocytosis
cjc04666  Fc gamma R-mediated phagocytosis
cjc04724  Glutamatergic synapse
cjc04912  GnRH signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc05200  Pathways in cancer
cjc05212  Pancreatic cancer
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100397093 (PLD1)
   00565 Ether lipid metabolism
    100397093 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100397093 (PLD1)
   04072 Phospholipase D signaling pathway
    100397093 (PLD1)
   04071 Sphingolipid signaling pathway
    100397093 (PLD1)
   04024 cAMP signaling pathway
    100397093 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100397093 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100397093 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100397093 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    100397093 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100397093 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100397093 (PLD1)
   05231 Choline metabolism in cancer
    100397093 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100397093 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100397093 (PLD1)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     100397093 (PLD1)
Membrane trafficking [BR:cjc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100397093 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    100397093 (PLD1)
SSDB
Motif
Pfam: PX PLDc_2 PLDc PH DUF3785
Other DBs
NCBI-GeneID: 100397093
NCBI-ProteinID: XP_017821175
Ensembl: ENSCJAG00000002296
LinkDB
Position
17
AA seq 1074 aa
MSLVNKPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVEYDVSPSDPKIQEVSIPFSA
IYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVREEPREMPSLPRSSENMMREEQFLGRR
KQLEDYLTKILKMPMYKNYHATAEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGLRID
NLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQENTSAKWYVNAKG
YFEDVANAMEEANEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY
KEVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSLAFVGGI
DLAYGRWDDDEHRLTDVGSVKRVTSGPSLGSLPAATTESVASLSLKDKNEPDQNLPTWKN
ADDTDTKLKGIGKPKKFSKFSLYRQLHRHHLHNADSISSIDSASSYFNHYRSHQNLIRGL
KPHFKLFRPSSESEQGLTRPNADTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRYSTPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLL
PKSQATAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVYVIENSKHYIYIE
NQFFISCADDKVVFNKVGDAIAQRILKAHRENKRYRVYVVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGEEYQAGRFAQGLRLQCF
RVVLGYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFI
NKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgtcactggtaaacaagccgcgggtaaatacctctgcactgcagaaaattgctgctgac
atgagcaatatcatagagaatctggacactcgggaactccattttgagggagaggaggta
gaatatgacgtgtctcccagcgatcccaagatccaggaagtgtctatccctttctctgct
atttataacactcaaggatttaaggagcctaatatacagacgtatctctccggctgtccg
ataaaagcacaagttctggaagtggaacgcttcacatctacaacaagggtaccgagtatt
aatctttacactattgaattaacacatggggaatttaaatggcaagttaagaggaaattc
aagcactttcaagaatttcacagagagctgctgaagtacaaagcctttatccgcatcccc
attcccactagaagacacacatttaggaggcaaaatgtccgagaggagcctcgagagatg
cccagtttgccccgttcatctgaaaacatgatgagagaagaacaattccttggcagaaga
aaacaactggaagattacttgacaaagatactaaaaatgcccatgtataaaaactatcat
gccacagcagagtttcttgatataagccagctatctttcatccatgatttgggaccaaag
ggcatagaaggtatgataatgaaaagatctggaggacacagaataccaggtttgaattgc
tgtggccagggaagagcctgctaccgatggtcaaaaagatggttaatagtgaaagattcc
tttttactgtatatgaaaccagacagcggtgccattgccttcgtcctgctggtagacaaa
gaattcaaaattaaggtggggaagaaggagacagaaacaaaatatggactccgaattgat
aatctttcaaggacacttattttaaaatgcaacagctataggcatgctagatggtgggga
ggggctatagaagaattcatccagaaacatggcaccaactttctcaaagatcatcgattt
gggtcgtatgctgctatccaagagaacacttcagctaaatggtatgttaatgccaaaggc
tattttgaagatgtggcaaatgcaatggaagaggcaaatgaagagatttttatcacagat
tggtggctgagtccagaaatcttcctgaaacgcccggtggttgagggaaatcgttggagg
ttggactgcattcttaaacgaaaagcacaacaaggggtgaggatcttcataatgctctac
aaagaggtagaactcgctcttggcatcaatagtgaatacaccaagaggactttgatgcgt
ctacaccccaacataaaggtgatgagacacccagatcatgtgtcgtctaccgtctatttg
tgggctcaccatgagaagcttgtcatcattgaccaatcgttggcctttgtgggtgggatc
gacctggcctatggaaggtgggatgacgatgagcacagactcacagacgtgggcagtgtg
aagcgggtcacttcaggaccgtctctgggttccctcccagctgcaacaacagagtctgtg
gcatccttaagcctcaaagataaaaatgaacctgatcaaaatttacccacctggaagaat
gctgatgatacggatacaaaactgaaaggaataggaaagccaaagaagttctccaaattt
agcctctacaggcagctccacaggcaccacctgcacaacgcagatagcatcagcagcatc
gacagcgcctccagttattttaaccactatagaagtcatcagaatttaatccgtggttta
aaaccccacttcaaactctttcgcccgtccagtgagtctgagcaaggactcactagacct
aatgctgataccgggtccatccgcagtttacagacaggtgtgggagagctgcatggggaa
accagattctggcatggaaaggattactgcaatttcgtcttcaaagactgggttcaactt
gataaaccttttgctgatttcattgacaggtactccacgccccggatgccctggcatgac
attgcctctgcagttcatgggaaggcggctcgtgatgtggcacgtcacttcatccagcgc
tggaacttcacgaaaattatgaaatcaaaatatcggtccctttcttatccttttctgctt
ccaaagtctcaagcaacagcccatgagttgagatatcaagtgcctggatctgtccatgct
aatgtacagttgctccgctctgctgctgattggtctgctggtataaagtaccatgaagag
tccatccatgccgcttatgtctacgtgatagagaacagcaagcactatatctatatcgaa
aaccagtttttcataagctgtgctgatgacaaagttgtgttcaacaaggtaggcgatgcc
attgcccagaggatcctcaaagcccacagggaaaacaagagataccgggtgtatgttgtg
ataccacttctgccagggttcgaaggagacatttcaaccggcggaggaaatgctctacag
gccatcatgcacttcaactacagaaccatgtgcagaggagaaaattccatccttggccag
ttaaaagcagagcttggtaatcagtggataaactacatatcattctgtggtcttagaaca
catgccgagcttgaaggaaacctagttactgagcttatctatgtccacagcaagttgtta
attgctgatgataacactgttattattggctctgccaacataaatgaccgaagcatgctg
ggaaagcgcgacagtgaaatggctgtcattgtgcaagatacagagacggttccttcagta
atggatggagaagagtaccaggctggccggtttgcccaaggacttcggctacagtgcttt
agggttgtccttggctatcttgatgacccaagtgaggacattcaggatccagtgagtgac
aaattcttcaaggaggtctgggtttcaacagcggctcgaaatgctacaatttatgataag
gtgttccggtgccttcccaatgatgaagtacacaacttaattcagctgagagactttata
aacaagcccgtattggctaaggaagatcccattcgagctgaggaggaactgaagaagatc
cgtgggtttctggtgcaattccccttttatttcttgtctgaagaaagcctgctgccttct
gttggcaccaaagaagccatagtgcccatggaggtttggacttaa

DBGET integrated database retrieval system