KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100392475
Entry
100392475         CDS       T03264                                 

Gene name
AXIN1
Definition
(RefSeq) axin 1
  KO
K02157  axin 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05213  Endometrial cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100392475 (AXIN1)
   04390 Hippo signaling pathway
    100392475 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100392475 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100392475 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100392475 (AXIN1)
   05225 Hepatocellular carcinoma
    100392475 (AXIN1)
   05226 Gastric cancer
    100392475 (AXIN1)
   05217 Basal cell carcinoma
    100392475 (AXIN1)
   05213 Endometrial cancer
    100392475 (AXIN1)
   05224 Breast cancer
    100392475 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100392475 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    100392475 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100392475 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100392475 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjc01009]
    100392475 (AXIN1)
Protein phosphatases and associated proteins [BR:cjc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100392475 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 100392475
NCBI-ProteinID: XP_009007071
Ensembl: ENSCJAG00000011809
LinkDB
Position
12
AA seq 831 aa
MNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDLRPANYSFCSGKGVGIKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFA
CTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPA
MFDQAQTEIQTTMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPT
LNEDEEWKCDQDVDEDDGRDTAPPGRLPQKLLLETAAPRASSSRRYSEGREFRYGSWREP
VNPYYVNAGYALAPATSANDTEQQCLSPVPDTLSLTDSSVDGMPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGEDGDPSSGPPGPCHKLPLTATWYHFPPRCVDVGCAGLRDAHEENPESILDEHVQRVLR
TPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVH
HSTARPKEQVEAEAARRAQSSFAWGLEPHIHGAKPRGYSESVGAAPNASDGLGHSGKVGM
ACKRNAKKAESGRNASTEVQGASEDTEKNQKIMQWIIEGEKEISRHRRAGHGSSGTRKPQ
SHENSRPLSLERSGTVHPWAGSQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLE
EEEKRASRAPSKQRARSQRKAGGGSTQACDSIVVAYYFCGEPIPYRTLVRGRAITLGQFK
ELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDGAVLPVFEEKIIGKVEKVD
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgaatgtccaggagcagggtttccccttggaccttggagcaagtttcaccgaagatgct
ccccgacccccagtgcctggtgaggagggagaactggtgtccacagacctgaggcctgcc
aactacagtttctgctccgggaaaggtgttggcattaaaggtgagacttcgaccgccact
ccgaggcgctcggatctggacctggggtatgagcctgagggcagtgcctcccccacccca
ccgtacttgaagtgggctgagtcactgcactccctgctggatgatcaagatgggataagc
ctgttcaggactttcctgaagcaggagggctgtgctgacttgctggacttctggtttgcc
tgcactggcttcaggaagctggagccctgtgactcgaacgaggagaagaggctgaagctg
gccagagccatctaccgaaagtacattcttgataacaatggcatcgtgtcccggcagacc
aagccggccaccaagagcttcataaagggctgcatcatgaagcagctgatcgatcctgcc
atgtttgaccaggcccagacagaaatccagaccaccatggaggaaaacacctacccctcc
ttccttaagtctgatatttatttggaatatacgaggacaggctcggagagcccgaaggtc
tgtagcgaccagagctctgggtcagggacggggaagggcatatctggatacctgccgact
ttgaatgaagatgaggaatggaaatgtgaccaggacgtggacgaggatgatggcagagac
actgctcctcctggaagactccctcagaagctgctcctggagacagctgccccgagggcc
tcctccagtcgacggtacagcgaaggcagagagttcaggtatggatcctggcgggagcca
gtcaacccctattatgtcaatgccggctatgccctggccccagccaccagtgccaacgac
accgaacagcagtgtttaagtcctgtcccagacaccctgtccctcacagacagcagcgtg
gatgggatgcccccatacaggatccgtaagcagcaccgcagggagatgcaggagagcgtg
caggtcaacgggcgggtgcccctacctcacattcctcgcacgtaccgggtgccaaaggag
gtccgcgtggagccacagaagttcgcagaggagctcatccaccgcctggaggctgtgcag
cgcacgcgggaggctgaggagaagctggaggagcggctgaagcgcgtgcgcatggaggag
gagggtgaagacggcgatccatcttcaggtcccccagggccgtgtcacaagctgcctctc
accgccacctggtaccactttccaccccgctgcgtggacgtgggctgtgccgggctccgg
gacgcacacgaggagaaccctgagagtatcttggatgagcacgtgcagcgtgtgctgagg
acacctggccgccagtcaccagggcctggccaccgctccccggacagtgggcatgtagcc
aagatgccagtggcgctgggaggtgcggcctcggggcacgggaagcatgtgcccaagtca
ggggcaaagctggatgcggccggcctgcaccaccaccgacacgtccaccaccatgtccac
cacagcacagcccggcccaaggagcaggtggaggctgaggctgcccgcagggcccagagc
agctttgcgtggggcctggagccacacatccatggggcaaagccccgaggctactcagag
agtgtgggcgctgcccccaacgccagtgatggcctgggccacagtgggaaggtgggcatg
gcatgcaaaagaaacgccaagaaggccgagtcggggaggaatgccagcaccgaggtacag
ggcgcctcggaggacacggagaagaaccagaagatcatgcagtggatcattgagggcgag
aaggagatcagcaggcaccggagggctgggcacgggtcttcagggacgaggaagccacag
tcccatgagaactccagacccttgtcccttgagcgctccgggaccgtgcatccctgggct
ggctctcagctccggacttccgtgcagccctcccacctctttatccaagaccccacgatg
ccaccccacccagctcccaaccccctaacccagctggaggaggcacgccgacgtctggaa
gaggaagagaaaagagccagccgggcaccctccaagcagagggccaggtcgcagcggaag
gcaggcggcgggagcacccaggcgtgcgacagcatcgtcgtggcgtactacttctgtggg
gagcccatcccctaccgaacgctggtgaggggccgcgccatcaccctgggccagttcaag
gagctgctgaccaaaaagggcagctaccgatactacttcaagaaagtgagcgacgagttt
gactgtggggtggtgtttgaggaggtccgagaggacggggccgtcctgcccgtcttcgag
gagaagatcatcggcaaagtggagaaggtggactga

KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100400518
Entry
100400518         CDS       T03264                                 

Gene name
AXIN2, axin-2
Definition
(RefSeq) axin 2
  KO
K04385  axin 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04310  Wnt signaling pathway
cjc04390  Hippo signaling pathway
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05165  Human papillomavirus infection
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05213  Endometrial cancer
cjc05217  Basal cell carcinoma
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100400518 (AXIN2)
   04390 Hippo signaling pathway
    100400518 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100400518 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100400518 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100400518 (AXIN2)
   05225 Hepatocellular carcinoma
    100400518 (AXIN2)
   05226 Gastric cancer
    100400518 (AXIN2)
   05217 Basal cell carcinoma
    100400518 (AXIN2)
   05213 Endometrial cancer
    100400518 (AXIN2)
   05224 Breast cancer
    100400518 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100400518 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    100400518 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100400518 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100400518 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100400518 (AXIN2)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100400518 (AXIN2)
SSDB
Motif
Pfam: RGS DIX AXIN1_TNKS_BD Axin_b-cat_bind DUF4827
Other DBs
NCBI-GeneID: 100400518
NCBI-ProteinID: XP_017824435
Ensembl: ENSCJAG00000017488
LinkDB
Position
5
AA seq 842 aa
MSSAVLVTRLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKSQVTKLMPVSSNIRRNED
GLGEPEGRASSDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTTYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEGSELTLSSREGAPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHPQYHSLL
PPGGKLPPAVTSPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVHC
FCPGGSEYYCYSKCKSHSKIPETMPGEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAPG
GAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRHH
LWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQQ
RDRSHSAAVQVGATPFSSPSLAPEDHKEPKKLAGVQALQASELVVTYFFCGEEIPYRRML
KAQSLTLGHFKEQLSKKGNLRYYFKKASDEFACGAVFEEVWDDETVLPMYEGRILGKVER
ID
NT seq 2529 nt   +upstreamnt  +downstreamnt
atgagtagtgctgtgttggtgactcgcctcccggaccccagcagcagcttccgtgaggat
gccccgcggcccccagtgccaggggaagaaggggagaccccaccgtgtcagccaggggtg
ggcaagagccaggtcaccaaactcatgcctgtctcttccaacatcaggcggaacgaagat
gggctgggggagccagaggggcgagcatcctctgattcccctctgactaggtggaccaag
tccttgcactccttgttgggcgatcaagacggtgcttacctcttccggactttcctggag
agggagaaatgcgtggataccttagacttctggtttgcctgcaatggattcaggcagatg
aacctgaaggataccaaaactttacgagtagccaaagcgatctacaaaaggtacattgaa
aacaacagcattgtctccaagcagctgaagcctgccaccaagacctacataagagacggt
atcaagaagcagcagattgattccatcatgtttgaccaggcgcagaccgagatccagtcg
gtgatggaggaaaatgcctaccagatgtttttgacttctgatatatacctcgaatatgta
aggagtgggggagaaaacacaacttacatgagtaacgggggactggggagcctcaaggtc
gtgtgtggctatctccccaccttgaacgaagaagaggagtggacttgtgctgacttcaag
tgcaaactttcgccaactgtggttggtttgtccagcaaaactctgagggccacagcaagt
gtgaggtccacggaaacagttgacagtggatacaggtccttcaagaggagcgatcctgtt
aacccttatcacgtaggctctggctatgtctttgcaccagccaccagtgccaatgacagt
gaaatatccagtgacgcgctgacagatgattccatgtccatgacggacagcagtgtagat
ggaattcctccttatcgtgtggggagtaagaaacagctccagagagaaatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcatttcccgagaacccaccgcctgcccaag
gagatgacccccgtggaacctgccacctttgcggctgagctgatctccaggctggagaag
ctgaagctggaactggagagccgccacagcctggaggagcgcctgcagcagatccgagag
gatgaagagaaggagggctccgagcttacactcagttcgcgggagggggcacctacacag
catcccctctccctactgccctctggcagctacgaggaggacccacagacgatcctggac
gatcacctgtccagggttctcaagacccctggctgccagtccccgggcgtaggccgctac
agtccccgctcccgctccccggaccaccaccaccaccacccgcagtaccactccctgctc
ccgcccggtggtaagctgcctccagccgtcacctcaccaggtgcctgccccctcctcggg
ggcaagggctttgtgaccaagcagacgacgaagcatgtccaccaccactacatccaccac
cacgccgtccccaagaccaaggaggagatcgaggcggaggccacgcagcgggttcactgc
ttctgccccgggggctccgagtattactgctactcgaaatgcaaaagccactctaagatt
ccagaaaccatgcccggcgagcagtttggcggcagcagaggcagtactttgcccaaacgc
aatgggaaaggcacggagccgggcctggctctgcccgccagggaaggaggggcccctggc
ggagccggggccctgcagcttccccgggaggaaggagacaggtcgcaggatgtctggcag
tggatgctggagagtgagcggcagagcaagcccaagccccatagtgcccaaagcacaaaa
aaggcctaccccttggaatctgcccgctcgtctccgggtgaacgagccagccggcaccac
ctgtgggggggcaacagcgggcacccccgtaccaccccccgtgcccacctgtttacccag
gaccctgcaatgcctcccctgaccccacccaacactctggctcaactggaggaggcctgt
cgcaggctggctgaggtgtctaagcccccaaagcagcggtgctgcgtggccagtcagcag
agggataggagtcactcggctgctgttcaggtgggagccacgcccttctccagtccaagc
ctggctccagaagatcacaaagagccaaagaagctggcaggtgtccaggcgctccaggcc
agtgagttggttgtcacttactttttctgtggggaagaaattccataccggaggatgctg
aaggctcagagtttgaccctgggccactttaaagagcagctcagcaaaaaggggaattta
aggtattacttcaaaaaagcaagcgatgagtttgcctgtggagcggtttttgaggaggtc
tgggacgacgagacagtgctcccgatgtatgaaggccggattctgggcaaagtggagcgg
attgattga

DBGET integrated database retrieval system