KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393089
Entry
100393089         CDS       T03264                                 

Gene name
INS
Definition
(RefSeq) insulin
  KO
K04526  insulin
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04114  Oocyte meiosis
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04152  AMPK signaling pathway
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04911  Insulin secretion
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04917  Prolactin signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04930  Type II diabetes mellitus
cjc04931  Insulin resistance
cjc04932  Non-alcoholic fatty liver disease
cjc04940  Type I diabetes mellitus
cjc04950  Maturity onset diabetes of the young
cjc04960  Aldosterone-regulated sodium reabsorption
cjc05010  Alzheimer disease
cjc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100393089 (INS)
   04014 Ras signaling pathway
    100393089 (INS)
   04015 Rap1 signaling pathway
    100393089 (INS)
   04066 HIF-1 signaling pathway
    100393089 (INS)
   04068 FoxO signaling pathway
    100393089 (INS)
   04072 Phospholipase D signaling pathway
    100393089 (INS)
   04022 cGMP-PKG signaling pathway
    100393089 (INS)
   04151 PI3K-Akt signaling pathway
    100393089 (INS)
   04152 AMPK signaling pathway
    100393089 (INS)
   04150 mTOR signaling pathway
    100393089 (INS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100393089 (INS)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100393089 (INS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100393089 (INS)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100393089 (INS)
   04910 Insulin signaling pathway
    100393089 (INS)
   04923 Regulation of lipolysis in adipocytes
    100393089 (INS)
   04913 Ovarian steroidogenesis
    100393089 (INS)
   04914 Progesterone-mediated oocyte maturation
    100393089 (INS)
   04917 Prolactin signaling pathway
    100393089 (INS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100393089 (INS)
  09149 Aging
   04211 Longevity regulating pathway
    100393089 (INS)
   04213 Longevity regulating pathway - multiple species
    100393089 (INS)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    100393089 (INS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100393089 (INS)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100393089 (INS)
   04940 Type I diabetes mellitus
    100393089 (INS)
   04950 Maturity onset diabetes of the young
    100393089 (INS)
   04932 Non-alcoholic fatty liver disease
    100393089 (INS)
   04931 Insulin resistance
    100393089 (INS)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 100393089
NCBI-ProteinID: XP_002755713
Ensembl: ENSCJAG00000035804
UniProt: F6YAF3
LinkDB
Position
11
AA seq 108 aa
MAPWMPLLPLLALLALWGPEPAPAFVNQHLCGPHLVEALYLVCGERGFFYAPKTRREAED
LQVGQVELGGGSITGSLPALEGPLQKRGVVDQCCTSICSLYQLQNYCN
NT seq 327 nt   +upstreamnt  +downstreamnt
atggccccgtggatgcccctcctgcccctgctggcactgctggccctctggggacccgag
ccagccccggcgtttgtgaaccagcacctgtgcggcccccacctggtggaagccctctac
ctggtgtgcggcgagcgaggtttcttctacgcacccaagacccgccgggaggcggaggac
ctgcaggtggggcaggtagagctgggtgggggctctatcacgggcagcctgccggccttg
gagggtcccctgcagaagcgtggcgtcgtggatcagtgctgcaccagcatctgctccctc
taccagctgcagaactactgcaactag

DBGET integrated database retrieval system