KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393283
Entry
100393283         CDS       T03264                                 

Definition
(RefSeq) 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
  KO
K07436  vitamin D3 24-hydroxylase [EC:1.14.15.16]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00100  Steroid biosynthesis
cjc01100  Metabolic pathways
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100393283
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100393283
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100393283
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cjc00199]
    100393283
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.16  vitamin D3 24-hydroxylase
     100393283
Cytochrome P450 [BR:cjc00199]
 Cytochrome P450, animal type
  CYP24 family
   100393283
SSDB
Motif
Pfam: p450 Kindlin_2_N
Other DBs
NCBI-GeneID: 100393283
NCBI-ProteinID: XP_008994394
Ensembl: ENSCJAG00000000625
LinkDB
Position
5
AA seq 514 aa
MSSPISKSRSLASFLQQQRSPRQPPRPVTSAVCTPPQPREVPVCPLAAGGETQNAAALPG
PTNWPLLGSLLQILWKGGLKKQHNTLAEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYR
TESAHPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPVEVMKLDNKIN
EVLADFMGRIDELCDENGRIEDLYSELNKWSLESICLVLYEKRFGLLQKNTGAEAVNFIM
AIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKSCIDNRLDKYSQQPGAD
LLCDIYHQNQLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQRVL
PENQVPRAEALRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYTLPKGTVLMLNTQ
VLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGIGKRMCIGRRLAELQLHLALCWIV
RKYDILATDNEPVEMLHLGTLVPSRELPIAFCQR
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgagctcccccatcagcaagagccgctcgctcgcctccttcctgcagcagcagcgaagt
ccgaggcagcccccgagacccgtgacctctgcggtgtgcacaccccctcagccacgagag
gtgccggtctgcccgctggcagctggtggcgagactcagaacgcggccgccttgccgggc
cccaccaactggccactgctgggcagtctgctgcagattctctggaaaggggggctcaag
aaacagcacaacaccctggcggagtaccacaagaagtatggcaagattttccgcatgaag
ctgggttcctttgagtcggtgcacctgggctcgccgtgcctgctggaagcgctgtaccgc
accgagagcgcgcacccgcagcggctggagatcaaaccatggaaggcctatcgcgactac
cgcaaagaaggctacgggctgctgatcctggagggtgaagactggcagcgggtccggagc
gcctttcaaaagaaactaatgaaaccagtggaagtgatgaagctggacaacaaaatcaat
gaggtcttggctgattttatgggcagaatagatgagctctgtgatgaaaacggccgcatt
gaagacttgtacagtgaactgaacaaatggtcacttgaaagtatctgcctcgtgttgtat
gagaagagatttgggcttctccagaagaatacgggggctgaagctgtgaacttcatcatg
gccatcaaaacaatgatgagcacgtttgggagaatgatggtcactccagtcgagctgcac
aagagcctcaacaccaaggtctggcaggaccacacactggcctgggacaccattttcaaa
tcagtcaaatcttgtattgacaaccgattggacaagtattctcagcagcctggtgcagat
ctcctttgtgacatttatcaccagaatcagctttcaaagaaagaattgtatgctgctgtc
acagagctccagctggctgcggtggaaacgacagcaaacagcctaatgtggattctctac
aatttatcccgtaatccccaagtgcaacaaaagcttcttaaagaaattcaaagagtatta
cctgagaatcaggtgccacgggcagaagctctgaggaatatgccatatttaaaagcctgc
ctgaaagaatctatgaggcttaccccgagtgtaccatttacaactcggactcttgacaag
gcaacagttctgggtgaatatactttacccaaaggaacagtgctgatgctgaatacccag
gtgttgggatccagcgaagacaattttgaagattccagtcagtttagacccgaacgttgg
cttcaggagaaggaaaaaatcaatcctttcgctcatcttccatttggcattggaaaaaga
atgtgcattggtcgccgattagctgagcttcaactgcacctggctctttgttggattgtc
cgcaaatatgacatcctggccacagacaacgagcctgttgagatgctgcacttaggcaca
ctggtgcccagccgggagctccccattgcgttctgccagcgataa

DBGET integrated database retrieval system