KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100393715Help
Entry
100393715         CDS       T03264                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00590  Arachidonic acid metabolism
cjc01100  Metabolic pathways
cjc04611  Platelet activation
cjc04726  Serotonergic synapse
cjc04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100393715 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100393715 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100393715 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    100393715 (PTGS1)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100393715 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 100393715
NCBI-ProteinID: XP_009000657
Ensembl: ENSCJAG00000020078
LinkDB All DBs
Position
1
AA seq 598 aa AA seqDB search
MSRSLLLRFSLFLLLLRPPHVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDGYQCDCTR
TGYSGPNCTIPELWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNAAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMRYPRGIRPESDGRGSGVLGCFPGLMLYA
TLWLREHNRVCDXLKSEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFD
PELLFGVQFQYRNRIALEFNQLYHWHPLMPDSFKVGSREYSYEQFLFNTSMLVDYGVEAL
VDAFSRQSAGRIGGGRNMDHHVLHVAVDVIRESRELRLQPFNEYRKRFGMKPYTSFQELV
GEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSP
EYWKPSTFGGEMGFNIVKTATLRKLVCLNTKTCPYVSFRVPDGSQDDGPAMERPSTEL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgagccggagtctcttgctccggttctcgctgttcctgctcctactgcggccgccccat
gtcctgctcgcggaccccggggcgcccacgccagtgaatccctgctgttactatccatgc
cagcaccagggcatctgtgtccgcttcggccttgacggctaccagtgtgactgcacccgc
acgggctattctggccccaactgcaccatccctgagctgtggacctggctccggaattca
ttgcggcccagcccctctttcacacacttcctgctcacgcatgggcgctggttctgggag
tttgtcaatgccaccttcatccgagagatgctcatgcgcctggtactcacagtgcgctcc
aaccttatccccagtccgcccacctacaacgcagcacatgactacatcagctgggagtct
ttctccaatgttagctattacactcgtattctgccctctgtgcctaaagactgccccaca
cccatgggaaccaaagggaagaagcagttgccagatgcccagctcctggcccgccgcttc
ttgctcaggaggaagttcatacctgacccccaaggcaccaacctcatgtttgccttcttt
gcacaacacttcacccaccagttcttcaaaacttctggcaagatgggtcctggcttcacc
aaggccttgggtcatggggtagacctcggtcacatttatggagacaatctggagcgtcag
tatcaactgcggctctttaaggatgggaaactcaagtaccaggtgctggacggagaaatg
taccctccctccgtagaagaggcgcctgtgttgatgcgctaccctcgaggcatccgccca
gagtcagatggtcgtgggtcaggagtgttgggctgcttcccgggcctcatgctgtatgcc
acgctctggctgcgcgagcacaatcgtgtgtgtgacnttctgaaatctgagcaccccacc
tggggagatgagcagctcttccagacgacccgcctcatcctcataggagagaccatcaag
attgttatcgaggagtacgtgcagcagttgagtggctatttcctgcagctgaagtttgac
ccagagctgctctttggtgtccagttccagtaccgcaaccgcattgccttggagttcaac
cagctctaccactggcaccccctcatgcccgactccttcaaggtgggctcccgggagtac
agctatgagcagttcttgttcaacacctccatgttggtggactacggggttgaggccctg
gtggatgccttctctcgccagagcgctggccggatcggtgggggcaggaacatggatcac
cacgtcctgcatgtggctgtggatgtcatcagggagtctcgggagctgcggctgcagccc
ttcaatgagtaccgcaagaggtttggcatgaagccctatacctccttccaggagcttgta
ggagagaaggagatggcagcggaattggaggagttgtatggagacattgatgcgttggag
ttctatcctgggctgcttcttgaaaagtgccatccgaactctatctttggggagagtatg
atagagattggggctcccttttccctcaagggtctcctagggaatcccatctgttctccg
gaatactggaagccaagcacatttggcggtgagatgggctttaacattgtcaagacggcc
acactgaggaagctggtctgccttaacaccaagacctgtccctacgtttccttccgcgtg
ccggatggcagtcaggatgatgggcctgctatggagcgaccgtccacagaactctga

DBGET integrated database retrieval system