KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394153Help
Entry
100394153         CDS       T03264                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00500  Starch and sucrose metabolism
cjc01100  Metabolic pathways
cjc04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100394153
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100394153
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100394153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 100394153
NCBI-ProteinID: XP_002751199
Ensembl: ENSCJAG00000031625
UniProt: F7IJU8
LinkDB All DBs
Position
7
AA seq 511 aa AA seqDB search
MKFFLLLLSIGLCWAQYFPNTQQGRTSIVHLFEWRWVDIALECERYLAPNGFGGVQVSPP
NENLVVNNPSRPWWERYQPISYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN
AAGAGTSSTCGSYFNAGNREFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGL
LDLALEKDYVRSKVAEYMNHLIDIGVAGFRLDASKHMWPGDIKAVLDKLHNLNSSWFPEG
SKPFIYQEVIDLGGEPITSSQYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWE
RYFENGKDINDWIGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQP
FTNWWDNGSNQVAFGRGNRGFIVFNNDDWSLSLTLQTGLPAGTYCDVISGDKINGNCTGI
KIYVSNDGKADFSISNSAEDPFIAIHVESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctttctgttgctcttatccatcgggttgtgctgggctcagtatttcccaaat
acacagcaaggacggacatctattgttcatctgtttgaatggcgatgggttgatattgct
cttgagtgtgagcgatacttagctcccaatggatttggaggggttcaggtctctccacca
aatgaaaatctcgtagttaacaacccttcaagaccttggtgggaaagataccaaccaatt
agctataaattatgcacaagatctggaaatgaagacgaatttagaaacatggtgactaga
tgtaacaatgttggagttcgtatttatgtggatgctgtgattaatcatatgtgtggcaat
gctgcgggtgcaggaacaagcagtacttgtggaagttacttcaacgctggaaatagggag
tttccagcagtcccatattctggatgggattttaatgatggtaaatgtaaaactggaagt
ggagatattgagaactataatgatgctacgcaggtcagagattgtcgtctggttggtctt
ctggatcttgcactggagaaagattatgtgcgttccaaggttgcagaatacatgaaccat
ctcattgacattggtgttgctggcttcagacttgatgcttccaagcacatgtggcctgga
gacataaaggcagttttggataaactgcataatctaaacagtagctggttccctgaagga
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattacaagcagt
cagtactttggaaatggccgggtgacagaattcaagtatggtgcaaaactcggcacagtt
attcgcaagtggaatggagagaagatgtcttacttaaagaactggggagaaggttggggt
ttcatgccttctgacagagcacttgtctttgtggataaccatgacaatcaacgaggacat
ggggctggaggagcttctattcttaccttctgggatgccaggctgtataaaatggcagtt
ggatttatgcttgctcatccttatggatttacacgagtgatgtcaagctaccgttgggag
agatattttgaaaatggaaaagatattaatgattggattgggccacctaataataatgga
gtaattaaagaagttactattaatccagacactacttgtggcaatgactgggtctgtgaa
catcggtggcgccaaataaggaacatggtcatcttccgcaatgtagtggatggccagcct
ttcacaaactggtgggataatggcagcaaccaagtggcctttgggagaggaaacagagga
ttcattgttttcaacaatgatgactggtcactttctttaactttgcaaactggtcttcct
gctggcacatactgtgatgtcatttctggagataaaattaatggcaattgtacaggcatt
aaaatttatgtttccaatgatggcaaggctgatttttctattagtaactctgctgaagat
ccgtttattgcaattcacgttgaatctaaattataa

DBGET integrated database retrieval system