KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100394403
Entry
100394403         CDS       T03264                                 

Gene name
SMO
Definition
(RefSeq) smoothened, frizzled class receptor
  KO
K06226  smoothened
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04340  Hedgehog signaling pathway
cjc04360  Axon guidance
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100394403 (SMO)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100394403 (SMO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100394403 (SMO)
   05205 Proteoglycans in cancer
    100394403 (SMO)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100394403 (SMO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjc04030]
    100394403 (SMO)
G protein-coupled receptors [BR:cjc04030]
 Frizzled / Smoothened family
  100394403 (SMO)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 100394403
NCBI-ProteinID: XP_009001349
Ensembl: ENSCJAG00000010304
UniProt: F7GPZ6
LinkDB
Position
8
AA seq 787 aa
MATARPARGPELPLLGLLLLLLLGGPGRGAASSGNATGPEPRSAGGSARRSAAVTGPPPP
LSHCGRAASCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWA
VIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEGCTN
EVQNIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAV
TGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGT
MRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYF
HLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLI
RGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEW
ERSFRDYVLCQANVTIGLPTKKPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKA
TLLIWRRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPV
AGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVEAE
ISPELQKRLGQKKKRRKRKKEVCPLAPPPELHPPAPAPSTVPRLPQLPRQKCLVAAGAWG
AGDSCRQGAWTLVSNPFCPEPSPPQGPFLPSAPAPMAWAHGRRQGLGPIHSRTNLMEAEL
MDADSDF
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggcaactgcccgccccgcgcgggggccggagctcccgctcctggggctgctgctgctg
ctgctgctggggggcccgggtcggggggcggcctcgagtgggaacgcgaccgggcctgag
ccgcggagcgcgggcgggagcgcgaggaggagcgcggcggtgaccggccctccgccgccg
ctgagccactgcggccgggcagcctcctgcgagccgctgcgctacaacgtgtgtttgggc
tcagtgctgccctacggggccacctccacgctgctggccggagactcggactctcaggag
gaagcgcacggcaagcttgtgctctggtcgggcctccggaatgccccccgctgctgggca
gtgatccagcccctgctgtgtgccgtatatatgcccaagtgtgagaatgaccgtgtggag
ctgcccagccgtaccctctgccaggccacccgaggcccctgtgccatcgtagagcgggag
cggggctggcctgacttcctgcgctgcactcctgaccgcttccctgaaggctgcacgaat
gaggtgcagaacatcaaattcaacagttcaggccagtgcgaagctcccttggttcggaca
gacaaccccaaaagctggtacgaggacgtggagggctgcggcatccagtgccagaacccg
ctcttcaccgaggccgagcaccaggacatgcacagctacatcgcggccttcggggccgtc
acaggcctctgcacactcttcaccctggccacatttgtggctgactggcggaactcgaat
cgctaccctgctgttatcctcttctacgtcaatgcctgcttctttgtgggcagcattggc
tggctggcccagttcatggatggtgcccgccgggagattgtctgccgtgcggatggcacc
atgaggcttggggagcccacctccaacgagactctgtcctgcgtcatcatctttgttatc
gtgtactacgccctgatggctggcgtggtttggtttgtggtcctcacctatgcgtggcac
acctccttcaaagccctgggcaccacctatcagcctctctcgggcaaaacctcctacttc
cacctgctcacctggtcactcccctttgtcctcactgtggcaatccttgctgtggcccag
gtggatggggactctgtgagcggcatctgttttgtgggctacaagaactaccgataccgt
gcgggcttcgtgctggcaccaatcggcctggtgctcatcgtgggaggctacttcctcatc
cgaggagtcatgactctgttctccatcaagagcaaccaccccgggctgcttagtgagaag
gccgccagcaagatcaacgagaccatgctgcgcctggggatttttggcttcctggccttt
ggttttgtgctcattaccttcagctgccacttctacgacttcttcaaccaggctgagtgg
gagcgcagcttccgggactatgtactgtgccaggccaatgtgaccatcgggctgcccacc
aagaagcccatccctgattgtgaaatcaagaatcgcccgagccttctggtggagaagatc
aacctgtttgccatgtttggaactggcatcgccatgagcacctgggtctggactaaggcc
acgctgctcatctggaggcgaacctggtgcaggttgactggtcagagtgacgatgagccc
aagcggatcaagaagagcaagatgattgccaaggccttctccaagcggcatgagctgctg
cagaacccgggccaggagctgtccttcagcatgcacaccgtgtcccacgacgggcccgtg
gcgggcttggcctttgacctcaatgagccctcagctgatgtctcctctgcctgggcccag
catgtcaccaagatggtggctcggagaggagccatactgccccaggacatttctgtcacc
cctgtggcaactccagtgcccccagaagaacaagccaacctgtggctggttgaggcagag
atctccccagagctgcagaagcgcctgggccagaagaagaagaggaggaagaggaagaag
gaggtgtgcccactggcaccacctcctgagcttcacccccctgcccctgcccccagtacc
gttcctcgactgcctcagctgccccggcagaaatgcctggtggctgcaggtgcctgggga
gctggggactcttgccgacagggagcctggaccctggtctccaacccattctgcccagag
cccagtccccctcagggtccgtttctgcccagtgcaccggcccccatggcctgggctcat
ggccgccgacagggtctggggcccattcactctcgcaccaacctgatggaggcagagctc
atggatgcagactcggacttctga

DBGET integrated database retrieval system