KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100402888
Entry
100402888         CDS       T03264                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04915  Estrogen signaling pathway
cjc05200  Pathways in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05223  Non-small cell lung cancer
cjc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100402888 (TGFA)
   04012 ErbB signaling pathway
    100402888 (TGFA)
   04014 Ras signaling pathway
    100402888 (TGFA)
   04151 PI3K-Akt signaling pathway
    100402888 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100402888 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100402888 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100402888 (TGFA)
   05212 Pancreatic cancer
    100402888 (TGFA)
   05225 Hepatocellular carcinoma
    100402888 (TGFA)
   05214 Glioma
    100402888 (TGFA)
   05211 Renal cell carcinoma
    100402888 (TGFA)
   05215 Prostate cancer
    100402888 (TGFA)
   05223 Non-small cell lung cancer
    100402888 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100402888 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 100402888
NCBI-ProteinID: XP_002757695
Ensembl: ENSCJAG00000019316
UniProt: A0A5F4VXH7
LinkDB
Position
14
AA seq 160 aa
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSMVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccctgttcgcgctgggtatcgtgttggctgcgtgc
caggccttggagaacagcacgtcccccttgagcgcagacccgcccgtggccgcagcagtg
gtgtctcattttaatgactgcccagattcccacactcagttctgcttccatggaacctgc
aggtttttggtgcaagaggacaagccagcttgtgtctgccattctgggtacgttggtgca
cgctgtgagcatgcggacctcctggccgtggtggccgccagccagaagaagcaggccatc
actgccttggtggtggtctccatggtggcccttgctgtccttatcattacatgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcac
gagaagcccagcgccctcctgaagggaaggactgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system