KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100403091
Entry
100403091         CDS       T03264                                 

Gene name
BRAF
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04015  Rap1 signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04068  FoxO signaling pathway
cjc04150  mTOR signaling pathway
cjc04270  Vascular smooth muscle contraction
cjc04510  Focal adhesion
cjc04650  Natural killer cell mediated cytotoxicity
cjc04720  Long-term potentiation
cjc04722  Neurotrophin signaling pathway
cjc04726  Serotonergic synapse
cjc04730  Long-term depression
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc05010  Alzheimer disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05034  Alcoholism
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05216  Thyroid cancer
cjc05218  Melanoma
cjc05219  Bladder cancer
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100403091 (BRAF)
   04012 ErbB signaling pathway
    100403091 (BRAF)
   04015 Rap1 signaling pathway
    100403091 (BRAF)
   04068 FoxO signaling pathway
    100403091 (BRAF)
   04024 cAMP signaling pathway
    100403091 (BRAF)
   04150 mTOR signaling pathway
    100403091 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100403091 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100403091 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100403091 (BRAF)
   04062 Chemokine signaling pathway
    100403091 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100403091 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    100403091 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100403091 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100403091 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100403091 (BRAF)
   04720 Long-term potentiation
    100403091 (BRAF)
   04730 Long-term depression
    100403091 (BRAF)
   04722 Neurotrophin signaling pathway
    100403091 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100403091 (BRAF)
   05205 Proteoglycans in cancer
    100403091 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100403091 (BRAF)
   05212 Pancreatic cancer
    100403091 (BRAF)
   05225 Hepatocellular carcinoma
    100403091 (BRAF)
   05226 Gastric cancer
    100403091 (BRAF)
   05214 Glioma
    100403091 (BRAF)
   05216 Thyroid cancer
    100403091 (BRAF)
   05221 Acute myeloid leukemia
    100403091 (BRAF)
   05220 Chronic myeloid leukemia
    100403091 (BRAF)
   05218 Melanoma
    100403091 (BRAF)
   05211 Renal cell carcinoma
    100403091 (BRAF)
   05219 Bladder cancer
    100403091 (BRAF)
   05215 Prostate cancer
    100403091 (BRAF)
   05213 Endometrial cancer
    100403091 (BRAF)
   05224 Breast cancer
    100403091 (BRAF)
   05223 Non-small cell lung cancer
    100403091 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100403091 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100403091 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    100403091 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100403091 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100403091 (BRAF)
   05160 Hepatitis C
    100403091 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100403091 (BRAF)
   01522 Endocrine resistance
    100403091 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100403091 (BRAF)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100403091 (BRAF)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100403091 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100403091
NCBI-ProteinID: XP_002751976
Ensembl: ENSCJAG00000013536
UniProt: U3CMC6
LinkDB
Position
8
AA seq 764 aa
MAALSGGGGGSAEPGQALFNGDMEPEAGAGAATSSAADPAIPEEVWNIKQMIKLTQEHIE
ALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASMDTVTS
SSSSSLSVLPSSLSVFQNPADVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLK
KALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTF
FTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQ
EEPSLAETALTSGSSPSAPPSDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDR
SSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGP
QRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKS
RWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNR
DQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
KIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH
NT seq 2295 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggtggcggtggcggcagcgcggagccgggccaggctctgttcaac
ggggacatggagcctgaggccggcgccggcgctgcgacctcttccgctgcggaccctgcc
attcctgaggaggtgtggaatatcaaacaaatgattaagttgacacaggaacatatagag
gcccttttggacaaatttggtggggagcataatccaccatcaatatatctggaggcatat
gaagaatacaccagcaagctagatgcactccaacaaagagaacaacagttattggaatct
ctggggaacggaactgatttttctgtttctagctctgcatcaatggacaccgttacatct
tcctcctcttcgagcctttcagtgctaccttcatctctttcagtttttcaaaatcccgca
gatgtgtcacggagcaaccccaagtcaccacaaaaacctatcgttagagtcttcctgccc
aacaaacagaggacagtggtacctgcaaggtgtggagttacagtccgagacagtctaaag
aaagcactgatgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggat
ggagagaagaaaccaattggctgggacactgatatctcctggcttactggagaagaattg
catgtggaagtgttggagaatgttccacttacaacacacaactttgtacgaaaaacattt
ttcaccttagcattttgtgacttttgtcgaaagctgcttttccagggtttccgctgtcaa
acgtgtggttataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaat
tatgaccaacttgatttgctgtttgtctccaagttctttgaacaccacccaataccacag
gaagagccttccttagcagagactgctcttacatctggatcatccccttccgcacccccc
tcagactctattgggccccaaattctcaccagtccatctccttcaaaatccattccaatt
ccacagcccttccgaccagcagatgaagatcatcgaaatcaatttgggcaacgagaccgg
tcctcatcagctcccaatgtgcatataaacacaatagaacctgttaatattgatgacttg
attagagaccaaggatttcgtggtgatggaggatcaaccacaggtttgtctgccacaccc
cctgcctcattacctggctcactcactaacgtgaaagccttacagaaatctccaggacct
cagagagaaaggaagtcatcttcatcctcagaagacaggaatcgaatgaaaacacttggt
agaagggactcgagtgatgattgggagattcctgatggacagattacagtgggacaaaga
attggatctggatcatttggaacagtttacaagggaaagtggcatggtgacgtggcagtg
aaaatgttgaatgtgacagcacctacacctcagcaattacaagccttcaaaaatgaagta
ggagtactcaggaaaacacgacacgtgaatatcctactcttcatgggctattccacaaag
ccacaactggctattgttacccagtggtgtgagggctccagcttgtatcaccatctccat
atcattgagaccaaatttgagatgatcaaacttatagatattgcacgacagactgcacag
ggcatggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatata
tttcttcatgaagacctcacagtaaaaataggtgattttggtctagccacagtgaaatct
cgatggagtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcacca
gaagtcatcagaatgcaagataaaaatccatatagctttcagtcagatgtatatgcattt
gggattgttctgtatgaattgatgactggacagttaccttattcaaacatcaacaacagg
gaccagataatttttatggtgggacgaggatacctatctccagatctcagtaaggtacgg
agtaactgtccaaaagccatgaagagattaatggcagagtgcctcaaaaagaaaagagat
gagagaccactgtttccacaaattctcgcctctattgagctgctggcccgctcattgcca
aaaattcaccgcagtgcatcagaaccctccttgaatcgggctggtttccaaacagaggat
tttagtctatatgcttgtgcttctccaaaaacacccatccaggcagggggatatggtgcg
tttcctgtccactga

DBGET integrated database retrieval system