KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404648
Entry
100404648         CDS       T03264                                 

Gene name
PDX1
Definition
(RefSeq) pancreatic and duodenal homeobox 1
  KO
K07594  insulin promoter factor 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04911  Insulin secretion
cjc04930  Type II diabetes mellitus
cjc04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100404648 (PDX1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100404648 (PDX1)
   04950 Maturity onset diabetes of the young
    100404648 (PDX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100404648 (PDX1)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    100404648 (PDX1)
SSDB
Motif
Pfam: Homeodomain Rib_recp_KP_reg
Other DBs
NCBI-GeneID: 100404648
NCBI-ProteinID: XP_002748960
Ensembl: ENSCJAG00000019393
UniProt: A0A5F4W8L7
LinkDB
Position
5
AA seq 282 aa
MNGEEQYYAATQLYKDPCAFQRGTAPEFSASPPACLYMGRQPPLPPPPFPGALGALEQGS
PPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFQEGAEPGALEEPSRVQLPFPW
MKSTKAHSWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAV
MLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGSGVAEPEQDCAVTSGEELLALPPP
PPPGGAVPPAAPAAAREGRLPPGLSASPQPSSVAPRRPQEPR
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaacggcgaggagcagtactacgcggccacgcagctttacaaggacccgtgcgcattc
cagcggggcacagcgccggagttcagcgccagcccccctgcgtgcctgtacatgggccgc
cagccgccgctgccgccgccgccgttccccggcgccctgggagcgctagagcaaggcagc
cccccggacatctccccgtatgaggtgcccccgctcgccgacgaccccgcggtggcgcac
ctccaccatcacctcccggctcagcttgcgctcccccacccgcccgccgggcccttccag
gaaggagcggagccgggcgccctggaggagcccagccgcgtccagctgcctttcccatgg
atgaagtctaccaaagctcactcgtggaaaggccagtgggcaggcggcgcctacgcggca
gagccagaggagaacaagcggacccgcaccgcctacacgcgcgcacagctgctggagctg
gagaaggagttcctattcaacaagtacatctcacggccgcgccgggtggagctggccgta
atgctgaacttgaccgagagacacatcaagatctggttccaaaaccgccgcatgaagtgg
aaaaaggaggaggacaagaaacgcggcggcgggacagctgtcgggggcagcggggttgcg
gagcctgagcaggactgcgccgtgacctccggcgaggagctgctggcgctgccgccgccg
ccgccgcccggaggtgccgtgccgcccgctgcccccgctgccgcccgagagggccgcctg
ccgcctggccttagcgcgtcgccacagccctccagcgtcgcgcctcggcggccgcaggaa
ccacggtga

DBGET integrated database retrieval system